DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Crisp2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:222 Identity:48/222 - (21%)
Similarity:81/222 - (36%) Gaps:64/222 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN 124
            |:...||||..|:       |....:.||.|          ||:.       ..:.:::|    |
  Rat    41 IIAKHNELRRQVS-------PPGSNILKMEW----------NVQA-------AANAQKWA----N 77

  Fly   125 NAVFQYSGAETE------------YTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKF 177
            |.:.::|..|..            .||....:..|::|:.|..|....:.|.     ||.||..:
  Rat    78 NCILEHSSTEDRKINIKCGENLYMSTDPTSWRTVIQSWYEENENFVFGVGAK-----PNSAVGHY 137

  Fly   178 TIAVAEKNTHVGC-AAVRFSRDFYNHFVLTCNFAT--SNIV--GQPVY--TPGEKATTGCKNRYG 235
            |..|...:..||| .|...::|...:|.: |::..  :|::  ..|.:  ||.......|.|   
  Rat   138 TQLVWYSSFKVGCGVAYCPNQDTLKYFYV-CHYCPMGNNVMKKSTPYHQGTPCASCPNNCDN--- 198

  Fly   236 AAYDYPNLCYAKEIYDNEKVIENTQTM 262
                  .||  ....|.|.::.|.:::
  Rat   199 ------GLC--TNSCDFEDLLSNCESL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 37/162 (23%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 37/164 (23%)
Crisp 189..243 CDD:400739 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.