DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CG9400

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster


Alignment Length:257 Identity:80/257 - (31%)
Similarity:131/257 - (50%) Gaps:19/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YCALPTC---------LDKHIACNNKGNFSENCPKDVREVKI-EPHHKLILNLFNELRNNVAGGK 75
            |||...|         ...|.||.|.|:||..|..:.:.::: |...:|:|::.|..|:.:|.|.
  Fly    50 YCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGN 114

  Fly    76 IEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAETEYTDA 140
            ::|...|..|..:.|..||..:|.|:.|.|:...||||:|.||.::|||...| :.|.|.: :.:
  Fly   115 LDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYF-WIGREFK-SHS 177

  Fly   141 EIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYN--HF 203
            ..:|..:.|||.|..:|:...:..:......|.:..||:.|:::...||||.|||.....|  .|
  Fly   178 RRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQF 242

  Fly   204 VLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC---YAKEIYDNEKVIENTQTM 262
            :||||:..:||..:|:|..| .|.:.|. ::..:..:|:||   .|....|:|:..|:..|:
  Fly   243 MLTCNYDYNNIFNEPIYQSG-PAGSKCP-QHRISEKFPSLCDWRDANNDLDSEESDEDGNTL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 52/153 (34%)
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 52/154 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440650
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.