DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CG31286

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:162 Identity:33/162 - (20%)
Similarity:58/162 - (35%) Gaps:69/162 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLTSLLGISLAADYCALPTCLDKHIACN--NKGNFSENCPKDVREVKIEPHHKLILNLFNELR 68
            ::|:.||:.:.|.|     .:..|::.|.|  |.|                    ::|...|:.|
  Fly     1 MLLIRSLVIVFLVA-----ISEFDRNFAINHDNAG--------------------IVLREINKRR 40

  Fly    69 NNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNV--KTCESLPDKCRSTERFAYAGQNNAVFQYS 131
            :.      .|:||               |.|.||  |.|:|          :|:....:|...||
  Fly    41 DR------HGVPK---------------LTLDNVLSKGCQS----------YAWKLSKSATLNYS 74

  Fly   132 G-AETEYTDA----EI----IKEQIENWFAER 154
            . ...:||::    |:    :...::||:..|
  Fly    75 DPTNKDYTESICRFEVKRGALSRCVKNWYNGR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 23/108 (21%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455154
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.