DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Crispld1

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:282 Identity:66/282 - (23%)
Similarity:102/282 - (36%) Gaps:65/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTSLLGISLAADYCALPTC------LDKHI-------ACNNKGN--FSENCPKDVREVKIEPHHK 58
            :|:||.::.|.....:|..      |:|::       ....:|.  .::|   |::.        
  Rat    11 MTALLFVARAVPAMVVPNATLLEKLLEKYMDEDDEWWTAKQRGKRAITDN---DMQS-------- 64

  Fly    59 LILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAYA 121
             ||:|.|:||:.|       .|.|..|..|:|..||...|....:||  |..|     |......
  Rat    65 -ILDLHNKLRSQV-------YPAASNMEYMTWDVELERSAESWAETCLWEHGP-----TSLLPSI 116

  Fly   122 GQNNAVFQYSGAE-TEYTDAEIIKEQIENWFAE-RSNASP---EILASFPEELPNKAVTKFTIAV 181
            |||      .||. ..|.....   .::.|:.| |..:.|   |.....|........|.:|..|
  Rat   117 GQN------LGAHWGRYRPPTF---HVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYTQVV 172

  Fly   182 AEKNTHVGCAA-VRFSRDFYNHF-----VLTCNFA-TSNIVGQPVYTPGEKATTGCKNRYGAAYD 239
            ...::.:|||. :..:.:.:...     .|.||:: ..|..|...|..| |..:.|...:|... 
  Rat   173 WATSSRIGCAINLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHG-KPCSACPPSFGGGC- 235

  Fly   240 YPNLCYAKEIYDNEKVIENTQT 261
            ..|||| ||..|.....:..:|
  Rat   236 RENLCY-KEGSDQYYTPQEEET 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 41/164 (25%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 41/173 (24%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.