DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Clec18a

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:195 Identity:46/195 - (23%)
Similarity:65/195 - (33%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLTSLLGISLAADYCALPTCLDKHI----ACNNKGNFSENCPKDVREVKIEPHHKLILNLFNE 66
            |:||..||||:...   ..|..|.|.:    |.:.|.:|                  |||...|.
  Rat    41 LLLLLPLLGITWTE---VQPPQLPKQVPIVQALSRKESF------------------LILTTHNR 84

  Fly    67 LRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAYAGQNNAVFQ 129
            ||:.|.       |.|..|.:|.|.|.|:.||......|  .:.|:...:.......|.|..:..
  Rat    85 LRSQVH-------PSAANMQRMDWSESLAQLAQARAALCGTSATPNLAATLRNTPDVGWNVQLLP 142

  Fly   130 YSGAETEYTDAEIIKEQIENWFAE----RSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 190
            ...|.        ..|.:..||||    |..::        |...|.....:|..|...::.:||
  Rat   143 MGSAS--------FVEVVNVWFAEGLQYRHGSA--------ECAHNATCAHYTQLVWATSSQLGC 191

  Fly   191  190
              Rat   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 33/139 (24%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 33/138 (24%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.