DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Glipr1

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:271 Identity:55/271 - (20%)
Similarity:89/271 - (32%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVA 72
            :.:|..|.|..|.  .||...::        :|.|.|        :|.|        |..|:   
  Rat    11 MASSASGFSYTAS--TLPKITNE--------DFIEEC--------VEVH--------NHFRS--- 46

  Fly    73 GGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPD-KCRSTERFAYAGQNNAVFQYSGAE 134
                :..|.|..|..|||..:|:.:|....::|  :..|. ..|....|...|:|    .:.|:.
  Rat    47 ----KAYPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNFTGLGEN----IWLGSL 103

  Fly   135 TEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDF 199
            :.::    ::..|..||.|..      ...|......|....:|..|...:..:|||.....|. 
  Rat   104 SLFS----VRAAILAWFEESQ------YYDFSTGKCKKVCGHYTQIVWADSYKIGCAVQLCPRG- 157

  Fly   200 YNHFVLTCNFATSNIVGQPVYTPGEKATTG-------CKNRYGAAYDYPNLC-------YAKEIY 250
             .:|:  ||:..:.  ..|.:...:.||..       |.|         |||       .::...
  Rat   158 -ANFI--CNYGPAG--NYPTWPYKQGATCSACPKDDKCLN---------NLCTNPQRDQVSRHSA 208

  Fly   251 DNEKVIENTQT 261
            |..|.:.|..|
  Rat   209 DYPKYLRNRYT 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 32/154 (21%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 37/176 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.