DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and PI16

DIOPT Version :10

Sequence 1:NP_650053.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_699201.2 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:232 Identity:54/232 - (23%)
Similarity:80/232 - (34%) Gaps:69/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAG 122
            :|::.|.|..|..|:       |.|..|..|.|.|||:..|....:.|....:|.|...     |
Human    34 RLMVELHNLYRAQVS-------PTASDMLHMRWDEELAAFAKAYARQCVWGHNKERGRR-----G 86

  Fly   123 QNNAVFQYSGAETEYTDAEIIKEQIENWFAERS--NASPEILASFPEELPNKAVTKFTIAVAEKN 185
            :|.......|.:        :...:|.|..||.  |.|....:      |.:....:|..|..|.
Human    87 ENLFAITDEGMD--------VPLAMEEWHHEREHYNLSAATCS------PGQMCGHYTQVVWAKT 137

  Fly   186 THVGCAAVRFSRDFYNHF-------------VLTCNF-ATSNIVGQPVY---TPGEKATTG--CK 231
            ..:||.         :||             :|.||: ...|:.|:..|   ||..:..:|  ||
Human   138 ERIGCG---------SHFCEKLQGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCK 193

  Fly   232 NR----YGAAYDYPNLCY---------AKEIYDNEKV 255
            |.    .|:..|..:|.|         |.|..|:.|:
Human   194 NSLCEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKM 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_650053.1 CAP_euk 57..210 CDD:349399 37/167 (22%)
PI16NP_699201.2 CAP_PI16_HrTT-1 33..166 CDD:349405 37/166 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.