DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Crisp2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:214 Identity:44/214 - (20%)
Similarity:83/214 - (38%) Gaps:48/214 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN 124
            |:|..||||.:|.       |....:.||.|       ::......:...:||    ...::.::
Mouse    41 IVNKHNELRRSVN-------PTGSDILKMEW-------SIQATTNAQKWANKC----ILEHSSKD 87

  Fly   125 NAVFQYSGAETEY--TDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTH 187
            :........|..|  ||..:....|::|:.|..:....:.|.     ||.||..:|..|...:..
Mouse    88 DRKINIRCGENLYMSTDPTLWSTVIQSWYNENEDFVYGVGAK-----PNSAVGHYTQLVWYSSFK 147

  Fly   188 VGCA-AVRFSRDFYNHFVLTCNFAT--SNIVGQPVYTPGEKAT------TGCKNRYGAAYDYPNL 243
            :||. |...::|...:|.: |::..  :|::.:.  ||.::.|      ..|:|         .|
Mouse   148 IGCGIAYCPNQDNLKYFYV-CHYCPMGNNVMKKS--TPYQQGTPCASCPNNCEN---------GL 200

  Fly   244 CYAKEIYDNEKVIENTQTM 262
            |  ....|.|.::.|.:::
Mouse   201 C--TNSCDFEDLLSNCESL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 33/152 (22%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 33/153 (22%)
Crisp 189..243 CDD:285731 7/40 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841356
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.