DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and scl-20

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_507655.1 Gene:scl-20 / 191309 WormBaseID:WBGene00013972 Length:212 Species:Caenorhabditis elegans


Alignment Length:240 Identity:65/240 - (27%)
Similarity:96/240 - (40%) Gaps:50/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGK--IEGLPK-- 81
            :...|.||     |:.:..     |...||         |::..|.||:.:|.|.  ::|:||  
 Worm     8 FLIFPNCL-----CDFRFG-----PTAQRE---------IVDFHNSLRSQLANGDYVVDGVPKPP 53

  Fly    82 AVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQ 146
            |..|.||.|...|:.:|..|..||.||....:...|..|....|..   ||:..:|  |....::
 Worm    54 AKDMMKMKWDPILAGMAKNNAATCPSLFTDSKMLGRNYYHRLANVT---SGSLDKY--ALFAVKK 113

  Fly   147 IENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCA-----AVRFSRDFYNHFVLT 206
            .|..|.||...:.| ...|.:   ::.:|..|..|.....||||.     |.:....:.|..|:.
 Worm   114 WERQFQERGWKNQE-FRMFGD---HRLLTSATQMVWATTRHVGCGVNICDAEKNLFGYRNKVVVI 174

  Fly   207 CNF-ATSNIVGQPVYTPGE-----KATTGCKNRYGAAYDYPNLCY 245
            |.: :..||.|.|:|..|.     .|:|.|:.|.|       ||:
 Worm   175 CEYQSKGNIHGLPIYKEGPTCSACPASTKCERRSG-------LCF 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 45/161 (28%)
scl-20NP_507655.1 SCP 23..177 CDD:214553 47/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19034
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.