DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and scl-21

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:200 Identity:52/200 - (26%)
Similarity:72/200 - (36%) Gaps:66/200 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGK-------IEGLPKAVRMAKMSWCEELSHLALLNVKTC----ES---- 107
            |.|:...|:||:.||..:       :|.||.|..|.||:|...|:..|....|||    ||    
 Worm    24 KEIVTYINDLRSLVASRRFHLDSRDVETLPPASDMLKMTWNSTLAVAAQKLAKTCFIAVESSSPG 88

  Fly   108 LPDKCRSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNK 172
            :.||     |...|   |.|             .:.|..:.:|           ..|..:|...|
 Worm    89 IADK-----RIVAA---NVV-------------TVAKNALGHW-----------KHSLNKEWNLK 121

  Fly   173 AVTKFTIAVA---EKNTHVGCAAVRFS--------RDFYNHFVLTCNF-ATSNIVGQPVYTPGEK 225
            :.....|.:.   .|::.|||.   ||        |.:|.   :.|:| ....|..:|||..| |
 Worm   122 SYNSNYIGIQLIWAKSSSVGCG---FSPCEIDSQGRRWYK---VVCSFEKKGGITREPVYKKG-K 179

  Fly   226 ATTGC 230
            |...|
 Worm   180 ACEAC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 44/178 (25%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 43/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.