DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and F57B7.2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001367203.1 Gene:F57B7.2 / 186438 WormBaseID:WBGene00010192 Length:330 Species:Caenorhabditis elegans


Alignment Length:224 Identity:42/224 - (18%)
Similarity:66/224 - (29%) Gaps:78/224 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LDKHI----------------ACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKI 76
            ||||:                ...::.||..:|                |:..||.|.....   
 Worm   126 LDKHMMQTITDVKYMIKHSKYTALSEVNFQRSC----------------LDAHNECRQRYGN--- 171

  Fly    77 EGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAY-----AGQNNAVFQYSGAETE 136
                     ..:.|..||:.:|       .:...|.....|..|     .|:|..:.:.:.....
 Worm   172 ---------ENLCWSTELAEMA-------HAWAVKLADRGRVLYPELPGIGENLILKEANEQSHL 220

  Fly   137 YTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFYN 201
            .|..|:|:|    |..|..      ...|.:...|....:|:..|.:..|.:|  |.|:.....|
 Worm   221 PTGQEVIQE----WEKEAQ------FFDFDKPRWNPKCQRFSQVVWKDTTELG--AARYWNTANN 273

  Fly   202 HFVLTCNF---ATSNIVGQPVYTPGEKAT 227
            ...:.|.:   ..||       .|||.|:
 Worm   274 CVAVVCFYRPAGNSN-------APGEFAS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 29/159 (18%)
F57B7.2NP_001367203.1 CAP_GAPR1-like 153..286 CDD:349401 32/179 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.