DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and vap-2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001300377.1 Gene:vap-2 / 181273 WormBaseID:WBGene00011462 Length:507 Species:Caenorhabditis elegans


Alignment Length:253 Identity:53/253 - (20%)
Similarity:85/253 - (33%) Gaps:77/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CALP--TCLDKHIACNNKGNF--SENCPKDV-REVKIEPHHKLILNLFNELRNNVA------GGK 75
            |.:|  .|....:..::.|:|  ..:...|| |...:|.|        |..|:.:|      |..
 Worm   284 CLVPEGLCQAPSMVKDDGGSFQCDNSLVSDVTRNFTLEQH--------NFYRSRLAKGFEWNGET 340

  Fly    76 IEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSG-------A 133
            ....|||.:|.||.:                    .| ..||||....||.||.:|.       .
 Worm   341 NTSQPKASQMIKMEY--------------------DC-MLERFAQNWANNCVFAHSAHYERPNQG 384

  Fly   134 ETEYTDA-------EIIKEQIENWFAERSN-ASPEILASFPE--ELPNKAVTKFTIAVAEKNTHV 188
            :..|..:       .:|...:|.|:.|... .:|......||  :|..||:..:|....::...:
 Worm   385 QNLYMSSFSNPDPRSLIHTAVEKWWQELEEFGTPIDNVLTPELWDLKGKAIGHYTQMAWDRTYRL 449

  Fly   189 GCAAVRFSRDFYNHFVLTCNFATSN--------IVGQ--------PVYTPGEKATTGC 230
            ||......:..|    :.|::..:.        .:|.        |:.|..||.|:.|
 Worm   450 GCGIANCPKMSY----VVCHYGPAGNRKNNKIYEIGDPCEVDDDCPIGTDCEKTTSLC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 36/174 (21%)
vap-2NP_001300377.1 SCP 104..253 CDD:214553
SCP 315..468 CDD:214553 39/185 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.