DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and scl-13

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:218 Identity:44/218 - (20%)
Similarity:71/218 - (32%) Gaps:69/218 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 ILNLFNELRNNVAGGKIEGL----PKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAY 120
            |::..|:||:.:|.|.....    |.|..|.|:.|.|.::..|   .:..|..||          
 Worm    26 IVDAHNKLRSAIAQGSYVAAGTQEPSASNMRKIVWDETVAAAA---QEYAEGCPD---------- 77

  Fly   121 AGQNNAVFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKF-------- 177
                    .:||  |.|.         ||.:...|:::|..|..|.....|...::|        
 Worm    78 --------DHSG--TSYG---------ENLYWSWSSSAPSSLDKFGVAASNSWESEFQKYGWTST 123

  Fly   178 ---------------TIAVAEKNTHVGCAAVRFSRD-----FYNHFVLTCNF-ATSNIVGQPVYT 221
                           .:|.|| .:.:||......:|     .|. ..:.|.: :..|::...:|.
 Worm   124 FLDEAGFATGIGHATQMAWAE-TSKIGCGIKNCGKDANKKNMYK-VAVVCQYDSAGNMMDSDIYQ 186

  Fly   222 PGEKATTGCKNRYGAAYDYPNLC 244
            .|| ..:.|........| ..||
 Worm   187 QGE-TCSACSEDASCEQD-SGLC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 36/182 (20%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 36/181 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.