DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Crispld2

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_612527.2 Gene:Crispld2 / 171547 RGDID:620860 Length:497 Species:Rattus norvegicus


Alignment Length:290 Identity:68/290 - (23%)
Similarity:101/290 - (34%) Gaps:86/290 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVK----IEPHHKL--------- 59
            ||.:::.:.||.            :.|..:..|..|.....|.:.    .|||.::         
  Rat     4 LLNNMVPVGLAL------------LVCGVQAFFLPNTMSLERLLSKYQHTEPHSRVRRAIPMSDR 56

  Fly    60 --ILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTC--ESLPDKCRSTERFAY 120
              ||.|.|:||..|       .|.|..|..|:|.|||...|....:.|  |..|     ......
  Rat    57 QEILMLHNKLRGQV-------YPPASNMEYMTWDEELERSAAAWAQRCLWEHGP-----ASLLVS 109

  Fly   121 AGQNNAV----FQYSGAETEYTDAEIIKEQIENWFAE-RSNASP---EILASFPEELPNKAVTKF 177
            .|||.||    ::..|.            .:::|:.| :....|   |.....||.......|.:
  Rat   110 IGQNLAVHWGRYRSPGF------------HVQSWYDEVKDYTYPYPHECNPWCPERCSGAMCTHY 162

  Fly   178 TIAVAEKNTHVGCAAVRFSR------DFYNHFV-LTCNFA-TSNIVGQPVYTPGEKATT------ 228
            |..|......:|| ||...|      |.:.:.| |.||:: ..|.:|:..|..|...:.      
  Rat   163 TQMVWATTNKIGC-AVHTCRSMSVWGDIWENAVYLVCNYSPKGNWIGEAPYKHGRPCSECPSSYG 226

  Fly   229 -GCKNRYGAAYDYPNLCYAKEIYDNEKVIE 257
             ||:|         ||||.:|.|..:..::
  Rat   227 GGCRN---------NLCYREEHYHQKPEVD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 44/179 (25%)
Crispld2NP_612527.2 SCP_euk 56..201 CDD:240180 44/169 (26%)
LCCL 286..370 CDD:128866
LCCL 389..487 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.