DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and CG43777

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:286 Identity:79/286 - (27%)
Similarity:132/286 - (46%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKSLILLTSLLGISLAADYCALPT--CL---DKHIACNNK-----GN---FSENCPKDVREVK 52
            |..:.|:.:..||.::...:||...|  |:   .||..|:.|     ||   |..:.|.::|   
  Fly     1 MMWRLLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNNMR--- 62

  Fly    53 IEPHHKLILNLFNELRNNVAGGKI-----EGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC 112
               ..|:.|::.|.|||..|||::     :...||.||.::.|.:||:::...:..|......:|
  Fly    63 ---MQKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQC 124

  Fly   113 RSTERFAYAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAERSNAS-PE-ILASFPEELPNK--A 173
            |||.||.:.|:..|:..   ...:....||..:.....|||..:.| |: :|.:|.   |::  .
  Fly   125 RSTLRFPHVGEAIALVT---PREKLNLKEIYSKAFTPMFAEYQHVSDPDALLHAFD---PDRDFQ 183

  Fly   174 VTKFTIAVAEKNTHVGCA---------AVRFSRDFYNHFVLTCNFATSNIVGQPVYTPGEKATTG 229
            |..||..::::.:.|||.         :::|.     || |||.|...|:.|..||..|: .|:.
  Fly   184 VRHFTNIISDRVSRVGCGVAVGANCNPSIKFC-----HF-LTCYFDFHNMAGSYVYKAGD-PTSS 241

  Fly   230 CKNRYGAAYD-YPNLC-YAKEIYDNE 253
            |.:....:.| |.||| .:.||:.::
  Fly   242 CDDWGVVSSDKYANLCKNSGEIFPHD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 47/169 (28%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 47/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440649
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.