DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Crisp3

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:216 Identity:40/216 - (18%)
Similarity:68/216 - (31%) Gaps:64/216 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNN 70
            |..|.::|..||..|              |::.|..|......:.|:.|     |::..|:||..
Mouse     7 LFFLAAVLPPSLLQD--------------NSQENSLEKLSTSKKSVQEE-----IVSKHNQLRRK 52

  Fly    71 VAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNAVFQYSGAET 135
            |:       |....:..|.|    ::.|.:|   .:...|||              .|.:|..|.
Mouse    53 VS-------PSGSDLLNMEW----NYDAQVN---AQQRADKC--------------TFSHSPIEL 89

  Fly   136 EYTDAEI------------IKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHV 188
            ..|:.:.            ....|:.|:    |.|..::.....:.....|...|..|.:.|..|
Mouse    90 RTTNLKCGENLFMSSYLVPWSSVIQGWY----NESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQV 150

  Fly   189 GCAAVRFSRDFYNHFVLTCNF 209
            .|.......:...:|.: |.:
Mouse   151 ACGVAECPENPLRYFYV-CRY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 29/164 (18%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 31/172 (18%)
Crisp 194..241 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.