DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and Crisp1

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:269 Identity:55/269 - (20%)
Similarity:99/269 - (36%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNN 70
            |..|.::|..||..|                  :..||..:.:...|:....: |::..|:||..
Mouse     7 LFFLAAVLPPSLLQD------------------SSQENRLEKLSTTKMSVQEE-IVSKHNQLRRM 52

  Fly    71 VAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---------RSTERFAYAGQNNA 126
            |:       |....:.||.|    ::.|.:|   .:...|||         |:|.  ...|:|..
Mouse    53 VS-------PSGSDLLKMEW----NYDAQVN---AQQWADKCTFSHSPIELRTTN--LRCGENLF 101

  Fly   127 VFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCA 191
            :..|..:   ::.|      |:.|:.|..:.:.::   .|:: |:..|..:|..|......|.|.
Mouse   102 MSSYLAS---WSSA------IQGWYNEYKDLTYDV---GPKQ-PDSVVGHYTQVVWNSTFQVACG 153

  Fly   192 AVRFSRDFYNHFVLTCNFA-TSNIVGQPVYTP---GEKATTG--------CKNRYGAAYDYPNLC 244
            .....::...::.: |::. ..|..|: :|||   ||...:.        |.|..|....|.|..
Mouse   154 VAECPKNPLRYYYV-CHYCPVGNYQGR-LYTPYTAGEPCASCPDHCEDGLCTNSCGHEDKYTNCK 216

  Fly   245 YAKEIYDNE 253
            |.|::...|
Mouse   217 YLKKMLSCE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 31/160 (19%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 31/165 (19%)
Crisp 190..244 CDD:285731 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.