DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and pi16

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031751055.1 Gene:pi16 / 101731805 XenbaseID:XB-GENE-22068880 Length:548 Species:Xenopus tropicalis


Alignment Length:178 Identity:39/178 - (21%)
Similarity:69/178 - (38%) Gaps:35/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KLILNLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKC---RSTERFA 119
            ::||:..|..|:...       |.|..|.|::|...|..:|       :|..:||   .:.:| .
 Frog    31 RIILDKHNFYRSQTE-------PSASDMIKLTWDSALEAMA-------KSYAEKCIWEHNKDR-G 80

  Fly   120 YAGQNNAVFQYSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEK 184
            :.|:|  :|..||:..:      :...:::|..||...:  ......:|  .:....:|..|...
 Frog    81 FIGEN--LFVMSGSSLD------VALGLDDWHKERGYYN--FTTGMCQE--GQMCGHYTQMVWAG 133

  Fly   185 NTHVGCAAVRFSR----DFYNHFVLTCNF-ATSNIVGQPVYTPGEKAT 227
            ...|||......:    |..|.::|.||: ...|..|:..|..|.:.|
 Frog   134 TERVGCGQNFCPKLEGVDDENMYLLVCNYEPPGNFEGESPYKEGSRCT 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 34/159 (21%)
pi16XP_031751055.1 CAP_PI16_HrTT-1 30..163 CDD:349405 34/158 (22%)
PHA03247 <200..414 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.