DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and LOC100536500

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:232 Identity:58/232 - (25%)
Similarity:84/232 - (36%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ALPTC----LDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFNELRNNVAGGKIEGLPKAV 83
            ||..|    |....||:..|..:|     :..|:.|     |:::.|..|..|.       |.|.
Zfish    12 ALVICFLGFLHMSAACSVTGVCTE-----LSSVQQE-----IVDVHNAFRRAVQ-------PSAS 59

  Fly    84 RMAKMSWCEELSHLALLNVKTCESL--PDKCRSTERFAYAGQNNAVFQYSGAE--TEYTDAEIIK 144
            .|.||||.:.::..|...:..|...  |...|....:. .|:|  :|:.:|..  |...||    
Zfish    60 NMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYE-MGEN--LFKATGISSWTSVVDA---- 117

  Fly   145 EQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRF-SRDFYN-HFVLTC 207
                 |.:|.:|....|     ..:..:|...:|..|...:..||||..:. |..||. |:....
Zfish   118 -----WHSEVNNYKYPI-----GSINGQATGHYTQVVWYSSYEVGCAVTQCGSNYFYGCHYYRAG 172

  Fly   208 NFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC 244
            ||.|     .|.|:.|....: |.|..     ..|||
Zfish   173 NFRT-----VPPYSLGSPCAS-CPNNC-----EDNLC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 38/157 (24%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.