DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scpr-C and LOC100490275

DIOPT Version :9

Sequence 1:NP_001287282.1 Gene:scpr-C / 41348 FlyBaseID:FBgn0037879 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031754789.1 Gene:LOC100490275 / 100490275 -ID:- Length:291 Species:Xenopus tropicalis


Alignment Length:290 Identity:67/290 - (23%)
Similarity:101/290 - (34%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAIKSLILLTSLLGISLAADYCALPTCLDKHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 65
            |.:..|:|:.|:.|...          ||...|.||:...::                 ::|..|
 Frog     1 MWLPQLMLVVSVCGARQ----------LDPTPAYNNERFVTD-----------------LVNAHN 38

  Fly    66 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTE----RFAYAGQNNA 126
            ::||..  ||     :|..|..|||...|:.||......|:.:|:...:.|    ||...|:|  
 Frog    39 DIRNEF--GK-----QAANMLHMSWDVGLAKLAQAWTINCKKVPNPHLNKESIYPRFKQIGEN-- 94

  Fly   127 VFQYSGAETEYTDAEIIKEQIENW-----FAERSNASPEILASFPEELPNKAVTKFTIAVAEKNT 186
              .|.|...:      |.:.:.||     |.:..|.|.:         |.|..:.||..|.....
 Frog    95 --LYMGPSID------IFKIVTNWGLEGNFYDLKNNSCQ---------PGKDCSHFTQIVWANTY 142

  Fly   187 HVGCAAVRFSRDFYNH---FVLTCNFA-TSNIVGQPVYTPGEKAT---------TGCKN-----R 233
            .|||.|.     :..|   :|::|.:. ..|::||..:..|.|.:         ..|.|     .
 Frog   143 KVGCGAA-----YCAHKVAYVVSCTYGPRGNLLGQVPFILGVKCSKCGGEKCNVASCGNPSRDEN 202

  Fly   234 YG--------AAYDYPNLCYAKEIYDNEKV 255
            ||        |..|...|.......:||||
 Frog   203 YGDYNYCPPFATIDCYRLSKGNVRVNNEKV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scpr-CNP_001287282.1 SCP_euk 58..210 CDD:240180 41/163 (25%)
LOC100490275XP_031754789.1 CAP 28..167 CDD:412178 41/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.