DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL3 and Mrpl3

DIOPT Version :9

Sequence 1:NP_524316.1 Gene:RpL3 / 41347 FlyBaseID:FBgn0020910 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_444389.2 Gene:Mrpl3 / 94062 MGIID:2137204 Length:348 Species:Mus musculus


Alignment Length:353 Identity:67/353 - (18%)
Similarity:110/353 - (31%) Gaps:142/353 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 GAVGYIETPFGLRALVNV--------------WAQHLSEECRRRFYKNWYKSKKKAFTKASKK-- 136
            ||.|....| ||....|:              |.:||||| ...|.|.....:.|  |:.:.|  
Mouse    18 GARGLGADP-GLERRKNILFFVRNLHSKSSTWWDEHLSEE-NLSFVKQLVSDENK--TQLTSKLN 78

  Fly   137 -------------------------------WTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRL 170
                                           ||.| |:|             ..:.::......:
Mouse    79 PLKDEPWPLHPWEPGSFRVGLIALKLGMMPLWTKD-GQK-------------HAVTLLQVQDCHV 129

  Fly   171 IKQRQKKAH---VMEIQLNGGSI------EDKVKWAREHLEKPIQVSNVF--------------- 211
            :|...|:.|   :..:.:.|.::      :.::::.|:....|.|:..:|               
Mouse   130 LKYTPKEDHNGKIAALTVGGKTVSRFYKPDSRLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLY 194

  Fly   212 ------GQDEMIDCVGVTKGKGFKGVTSRWHTKKLP-----RKTHKGLRKVACIGAWHPSRVSTT 265
                  ||  .:|....|.||||:||..||..|..|     .|||   |:...|.....:||...
Mouse   195 AAHFRPGQ--YVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTH---RRPGAISTGDIARVWPG 254

  Fly   266 VARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIKNNASTEYDLTDKSITPMGGFPHYGEVNNDF 330
            ....|:.|..:||....|::|    ::||                                 ::.
Mouse   255 TKMPGRMGNQNRTVYGLKVWR----VNTK---------------------------------HNI 282

  Fly   331 VMIKGCCIGSKKRIITLRKSLLKHTKRS 358
            :.:.|...|.|..::.::.|.|...|.|
Mouse   283 IYVNGSVPGHKNCLVKIKDSTLPAYKDS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL3NP_524316.1 PTZ00103 1..400 CDD:240267 67/353 (19%)
Mrpl3NP_444389.2 Ribosomal_L3 2..340 CDD:278714 67/353 (19%)
L3_bact 98..300 CDD:274684 45/257 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.