DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL3 and mRpL3

DIOPT Version :9

Sequence 1:NP_524316.1 Gene:RpL3 / 41347 FlyBaseID:FBgn0020910 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_511166.2 Gene:mRpL3 / 32523 FlyBaseID:FBgn0030686 Length:362 Species:Drosophila melanogaster


Alignment Length:155 Identity:37/155 - (23%)
Similarity:52/155 - (33%) Gaps:48/155 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKLP-----RKTHKGLRKVACIGAWHPSRVS 263
            |:.| |.|...:.:|..|.|...||:||..|...|.:|     .|||:....:.  |.....||.
  Fly   205 PLNV-NHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIG--GGGEKGRVW 266

  Fly   264 TTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIKNNASTEYD---LTDKSIT-PMGG----- 319
            ......|..|...|.....:::||                :|:|:   :...|:. |.||     
  Fly   267 PGTKMPGHMGNRWRIIKGLRVWRI----------------NTKYNVMWVQGSSVAGPTGGLVYIY 315

  Fly   320 --------------FP-HYGEVNND 329
                          || .|||...|
  Fly   316 DTILPTRKNKEAPPFPTFYGEPQQD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL3NP_524316.1 PTZ00103 1..400 CDD:240267 37/155 (24%)
mRpL3NP_511166.2 RplC 101..314 CDD:294230 31/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.