DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL3 and MRPL3

DIOPT Version :9

Sequence 1:NP_524316.1 Gene:RpL3 / 41347 FlyBaseID:FBgn0020910 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_009139.1 Gene:MRPL3 / 11222 HGNCID:10379 Length:348 Species:Homo sapiens


Alignment Length:266 Identity:58/266 - (21%)
Similarity:87/266 - (32%) Gaps:94/266 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 WAQHLSEECRRRFYKNWYKSKKKAFTKASK--------------------------------KWT 138
            |.:||||| ...|.|.....:.|| ..|||                                .||
Human    49 WDEHLSEE-NVPFIKQLVSDEDKA-QLASKLCPLKDEPWPIHPWEPGSFRVGLIALKLGMMPLWT 111

  Fly   139 DDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQK-----KAHVMEIQLNGGSIEDKVKWAR 198
            .| |:|             .|:.::......::|...|     |...:.:   ||....:.:.|.
Human   112 KD-GQK-------------HVVTLLQVQDCHVLKYTSKENCNGKMATLSV---GGKTVSRFRKAT 159

  Fly   199 EHLE----------KPIQVSNV----------------FGQDEMIDCVGVTKGKGFKGVTSRWHT 237
            ..||          :.:::.|:                |...:.:|....|.||||:||..||..
Human   160 SILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGF 224

  Fly   238 KKLP-----RKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGK 297
            |..|     .|||   |:...:......||.......|:.|..:|||...|::|    |:||...
Human   225 KGQPATHGQTKTH---RRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWR----INTKHNI 282

  Fly   298 VIKNNA 303
            :..|.:
Human   283 IYVNGS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL3NP_524316.1 PTZ00103 1..400 CDD:240267 58/266 (22%)
MRPL3NP_009139.1 Ribosomal_L3 3..340 CDD:395233 58/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.