DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6693 and CG8531

DIOPT Version :10

Sequence 1:NP_650052.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:175 Identity:45/175 - (25%)
Similarity:74/175 - (42%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STLELCEKYFGTRDVYKLMELARGAGEKEVKKAYHKLSLLVHPDR-VPEEQKAESTEKFKVLSKL 65
            |..||.|.|      |..:.|.|.|..:::..||.|.|.:.|||: :..:.|..:...|....:.
  Fly     8 SDAELDENY------YTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRA 66

  Fly    66 YQVLTDTQKRALYDEQGVIDDDDESESKLSSWLELWSKIFKPITEEDINNYEKEYVESELERTDL 130
            |:||:|.|:||:||..|        |..|.:  |.|..:.:..|.::|....:...::..||...
  Fly    67 YEVLSDPQQRAIYDSVG--------EKGLRT--EGWEILHRTKTPDEIREEYERLAQAAAERRLQ 121

  Fly   131 KKAYLGGKGCINYLMNHVPFMKVEDE--PRIQKIVQDMIASGEVP 173
            ::....|...||.....: |...:|.  |.::.....:..|.|.|
  Fly   122 QRTNPRGNITINVNATEI-FAPYDDSEMPHVEIGSMSIAQSIEAP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6693NP_650052.1 DnaJ 15..79 CDD:395170 20/64 (31%)
CG8531NP_610945.1 DnaJ 15..>123 CDD:440252 32/123 (26%)
DnaJ-like_C11_C 400..538 CDD:463378
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.