| Sequence 1: | NP_650052.1 | Gene: | CG6693 / 41346 | FlyBaseID: | FBgn0037878 | Length: | 299 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_610467.1 | Gene: | Rme-8 / 35939 | FlyBaseID: | FBgn0015477 | Length: | 2408 | Species: | Drosophila melanogaster |
| Alignment Length: | 42 | Identity: | 13/42 - (30%) |
|---|---|---|---|
| Similarity: | 25/42 - (59%) | Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 EKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVL 69 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6693 | NP_650052.1 | DnaJ | 15..79 | CDD:395170 | 13/42 (31%) |
| Rme-8 | NP_610467.1 | RME-8_N | 12..835 | CDD:466078 | |
| GYF_2 | 972..1026 | CDD:464112 | |||
| DnaJ | 1304..1356 | CDD:395170 | 13/42 (31%) | ||
| HEAT repeat | 2174..2200 | CDD:293787 | |||
| HEAT repeat | 2212..2243 | CDD:293787 | |||
| HEAT repeat | 2253..2282 | CDD:293787 | |||
| HEAT repeat | 2291..2327 | CDD:293787 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||