DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6693 and CG2887

DIOPT Version :10

Sequence 1:NP_650052.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_572633.1 Gene:CG2887 / 31978 FlyBaseID:FBgn0030207 Length:342 Species:Drosophila melanogaster


Alignment Length:68 Identity:27/68 - (39%)
Similarity:45/68 - (66%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RDVYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALY 78
            :|.||::.:.|.|.:.|::|||||.:|..|||:   .:..::.|.||.::|.|:||:|.:||..|
  Fly     3 KDYYKILGIQRTANDGEIRKAYHKQALRYHPDK---NKSPQAEEIFKQVAKAYEVLSDKKKRGSY 64

  Fly    79 DEQ 81
            |.:
  Fly    65 DSR 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6693NP_650052.1 DnaJ 15..79 CDD:395170 25/63 (40%)
CG2887NP_572633.1 DnaJ_bact 4..331 CDD:274090 27/67 (40%)

Return to query results.
Submit another query.