DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6693 and dnj-7

DIOPT Version :10

Sequence 1:NP_650052.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 / 180983 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans


Alignment Length:81 Identity:32/81 - (39%)
Similarity:50/81 - (61%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GTRDVYKLMELARGAGEKEVKKAYHKLSLLVHPDRV-PEEQKAESTEKFKVLSKLYQVLTDTQKR 75
            |.||.||::.:.|.|.::|:.|||.||:...|||.. .||:|.::.:||..::...:||.|.:||
 Worm   376 GKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAEKKFIDIAAAKEVLQDEEKR 440

  Fly    76 ALYDEQGVIDDDDESE 91
            ..:| |||...|.|::
 Worm   441 RQFD-QGVDPLDPEAQ 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6693NP_650052.1 DnaJ 15..79 CDD:395170 24/64 (38%)
dnj-7NP_509209.1 TPR 29..>198 CDD:440225
TPR repeat 29..54 CDD:276809
PEP_TPR_lipo 58..>410 CDD:274350 15/33 (45%)
TPR repeat 59..89 CDD:276809
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809
DnaJ 379..444 CDD:395170 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.