DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6693 and dnj-28

DIOPT Version :10

Sequence 1:NP_650052.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_491084.1 Gene:dnj-28 / 171870 WormBaseID:WBGene00001046 Length:494 Species:Caenorhabditis elegans


Alignment Length:78 Identity:26/78 - (33%)
Similarity:48/78 - (61%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GTRDVYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEE-QKAESTEKFKVLSKLYQVLTDTQKR 75
            |.||.||::.:.|.|.::|:.|||.|::...|||...:| :|.::.:||..::...:||::.:||
 Worm   377 GKRDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKR 441

  Fly    76 ALYDE-QGVIDDD 87
            ..:|. |..:|.:
 Worm   442 RAFDNGQDPLDSE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6693NP_650052.1 DnaJ 15..79 CDD:395170 21/64 (33%)
dnj-28NP_491084.1 NlpI <23..>122 CDD:443815
TPR repeat 28..52 CDD:276809
TPR repeat 57..87 CDD:276809
TPR repeat 92..116 CDD:276809
LapB 167..>363 CDD:442196
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 291..321 CDD:276809
TPR repeat 326..352 CDD:276809
DnaJ 380..445 CDD:395170 21/64 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.