DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and WIP3

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:187 Identity:46/187 - (24%)
Similarity:64/187 - (34%) Gaps:46/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 CPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQK----HESEVHNAAPRLIVKRINP 478
            |.|.|:......:|:     |...|||..||:||......|.    |.||....|..|       
plant   161 CGKRFWIPSPAQIHV-----GPMQFACSICSKTFNRYNNMQMHMWGHGSEFRKGADSL------- 213

  Fly   479 KPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQR-----CSKSYSDPNKLKRH-E 537
            |...:|...:|..|..|                     |..|:.     .||...|...|:.| :
plant   214 KGTIQPAAILRLPCYCC---------------------AEGCKNNINHPRSKPLKDFRTLQTHYK 257

  Fly   538 MTHEKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANS 594
            ..|..:|..|..|.|....:...|.||. :.|:  .|...|..:|::|.::|.|..|
plant   258 RKHGSKPFSCGKCGKALAVKGDWRTHEK-NCGK--LWYCTCGSDFKHKRSLKDHIRS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523
C2H2 Zn finger 387..407 CDD:275368
zf-H2C2_2 399..422 CDD:290200 2/3 (67%)
C2H2 Zn finger 415..436 CDD:275368 4/17 (24%)
C2H2 Zn finger 444..460 CDD:275368 6/19 (32%)
C2H2 Zn finger 492..512 CDD:275368 2/19 (11%)
C2H2 Zn finger 520..540 CDD:275368 6/25 (24%)
C2H2 Zn finger 547..567 CDD:275368 6/19 (32%)
zf-met 574..597 CDD:289631 7/21 (33%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.