| Sequence 1: | NP_650051.1 | Gene: | CG6689 / 41345 | FlyBaseID: | FBgn0037877 | Length: | 613 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006234777.1 | Gene: | Zfp770 / 691610 | RGDID: | 1597283 | Length: | 699 | Species: | Rattus norvegicus |
| Alignment Length: | 259 | Identity: | 70/259 - (27%) |
|---|---|---|---|
| Similarity: | 107/259 - (41%) | Gaps: | 57/259 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 379 RAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFA 443
Fly 444 CGFCSETFAYPGARQKHESEVHNAA--PRLIVKRINPKPMPKP---------------------- 484
Fly 485 ---------RESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH 540
Fly 541 -EKRPLQCDVCLKGFYQRTRLREHELIHTGER-----------PYWCEVCNVNFRYKYNMKSHA 592 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6689 | NP_650051.1 | THAP | 2..96 | CDD:283206 | |
| zf-AD | 167..240 | CDD:214871 | |||
| zf-C2H2 | 385..407 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 387..407 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 399..422 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 415..436 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 444..460 | CDD:275368 | 3/15 (20%) | ||
| C2H2 Zn finger | 492..512 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 520..540 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 547..567 | CDD:275368 | 7/19 (37%) | ||
| zf-met | 574..597 | CDD:289631 | 6/19 (32%) | ||
| C2H2 Zn finger | 575..591 | CDD:275368 | 5/15 (33%) | ||
| Zfp770 | XP_006234777.1 | C2H2 Zn finger | 27..47 | CDD:275368 | 6/19 (32%) |
| C2H2 Zn finger | 55..75 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 81..101 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 160..180 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 188..208 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 216..236 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 480..500 | CDD:275368 | |||
| C2H2 Zn finger | 508..528 | CDD:275368 | |||
| C2H2 Zn finger | 635..655 | CDD:275368 | |||
| C2H2 Zn finger | 663..683 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24376 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||