DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG17801

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:498 Identity:117/498 - (23%)
Similarity:181/498 - (36%) Gaps:185/498 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEV------ISGVWISHKPDEPRLMCPAC 217
            :|..:...|.:|             |...|..::|.:||      ::|:|:.....:||.:||:|
  Fly     5 KKPSQCHLCASC-------------FCHLNPTIIFCLEVLAKIKDLTGIWLEQNERQPRHICPSC 56

  Fly   218 KSALDQAIDF--------------REMCISTELK--LSQAKPSTDEVQIEAE------------- 253
            .:.|:.:|..              ||..:..:|:  :|..:|..|...:|:|             
  Fly    57 LNDLNTSIKLKKRIQRVHNEATLRRESGLDEDLESTVSDIEPEGDSSDLESEESYDSENYPFDKK 121

  Fly   254 ----------------NE--NPISSDHDLISDTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVD 300
                            ||  ||..|:..||...:|..:|....|            ::.....||
  Fly   122 AEESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPLIETPSFA------------NENLPNKVD 174

  Fly   301 EVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQKP--KRSAN 363
              |:||...:.:.:....:    ||..|..     ::...|:|..|   |..|.|..|  ||:|.
  Fly   175 --AKSPKKGNFIQIGTDLR----LLTTYPS-----IKVVKPLALAP---EDVAAENVPPAKRTAR 225

  Fly   364 PKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMR 428
                             |..:.||.:||:.|:..:||:.||:|||..||:.||.|.|.|...|:.
  Fly   226 -----------------KMQSLVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYLA 273

  Fly   429 NMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCK 493
            .:|.|:||.||.||.|.|||.||....|:..||.          ::.|         ..:||   
  Fly   274 RLHERVRHMGEQPFECNFCSATFFTSTAKSSHER----------IRHI---------RDLRY--- 316

  Fly   494 LCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQCDVCLKGFYQRT 558
                                                                |||.|.|.|..:|
  Fly   317 ----------------------------------------------------QCDQCTKRFNTKT 329

  Fly   559 RLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNA 601
            .|.:|:.:|:|.:|:.|.:|.:||..|..::||.:|..||..|
  Fly   330 CLNKHKFLHSGLKPFDCVICQINFARKATLRSHFDSVAHQKRA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 19/94 (20%)
zf-C2H2 385..407 CDD:278523 9/21 (43%)
C2H2 Zn finger 387..407 CDD:275368 8/19 (42%)
zf-H2C2_2 399..422 CDD:290200 13/22 (59%)
C2H2 Zn finger 415..436 CDD:275368 8/20 (40%)
C2H2 Zn finger 444..460 CDD:275368 7/15 (47%)
C2H2 Zn finger 492..512 CDD:275368 0/19 (0%)
C2H2 Zn finger 520..540 CDD:275368 0/19 (0%)
C2H2 Zn finger 547..567 CDD:275368 8/19 (42%)
zf-met 574..597 CDD:289631 8/22 (36%)
C2H2 Zn finger 575..591 CDD:275368 5/15 (33%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 16/77 (21%)
zf-C2H2 231..252 CDD:278523 9/20 (45%)
C2H2 Zn finger 232..252 CDD:275368 8/19 (42%)
zf-H2C2_2 244..269 CDD:290200 14/24 (58%)
C2H2 Zn finger 260..281 CDD:275368 8/20 (40%)
C2H2 Zn finger 289..308 CDD:275368 9/28 (32%)
C2H2 Zn finger 318..338 CDD:275368 8/19 (42%)
C2H2 Zn finger 346..362 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.