DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG17806

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650658.1 Gene:CG17806 / 42142 FlyBaseID:FBgn0038548 Length:421 Species:Drosophila melanogaster


Alignment Length:488 Identity:125/488 - (25%)
Similarity:190/488 - (38%) Gaps:147/488 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMC 231
            ||||..:..   .||.|||.....:|.:|..::|.|:.::|..|..:|.:|...|:.||.|||.|
  Fly     5 CRTCGQEAE---HAKSLFDKEARDVLSNILKLTGFWLRNQPGVPTRICLSCLLDLNDAIAFRERC 66

  Fly   232 ISTELKLSQAKPSTDEVQIEAENE---NPISSDHDLIS------------------------DTE 269
            |.|.....:.:...::...|...|   |.:.|..|::.                        .|.
  Fly    67 IRTNSSWFEKQGKQEDSDTETAREGGNNRLESRVDVMPISIAQPQRRRILPQRSKKVDGVPLKTV 131

  Fly   270 NTN-----VEEIEDAGGDHV-----ED--EATSDDQTSQEAVDEVA--ESPAAQDPLSVALGAKI 320
            .|.     |.||..|  |.|     ||  :..|:.|.|.:...|..  |.||::.|       ::
  Fly   132 ETPIYPLVVPEIPPA--DLVDPLRCEDPIQVKSEPQLSSDYPVESMNHEEPASEMP-------QV 187

  Fly   321 FKE--LLDQYTGKEKARLRKGAPIASKPKAK---EKAAGEQKPK----RSANPKTKEERNLIRRA 376
            .||  ...|..|:.:...|       ||::|   |:..|:...|    .|...|||||:...|..
  Fly   188 MKEEPRTLQVIGEVQKNRR-------KPRSKGCLEECPGKDMAKIENIDSTTNKTKEEKYATRNK 245

  Fly   377 QLRAKPPN------FVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIR 435
            ...||...      :.|||||:.|....|..:|:.||..||.:||.||.:..:..::.|:|:||:
  Fly   246 WGAAKRAYALEHRLYFCDQCGKTFSEKGNFNVHLRRHKGTKEFQCQECDRMEFTQHLLNLHVRIK 310

  Fly   436 HRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYA 500
            ||||.|:.|.:|.:.|             .|.     :||:|                       
  Fly   311 HRGELPYVCKYCGKRF-------------DNC-----LKRLN----------------------- 334

  Fly   501 SKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQCDVCLKGFYQRTRLREHEL 565
                   |.::|.::..:                        ||..|..|.|.|...|.|::|.:
  Fly   335 -------HERNHKESPVH------------------------RPHVCSTCQKAFKTSTALKDHIV 368

  Fly   566 IHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQ 598
            :||||:|:.||:|...|..:..:.:|..||.|:
  Fly   369 VHTGEQPFHCELCQTFFNRRNALATHYKSKHHR 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 26/72 (36%)
zf-C2H2 385..407 CDD:278523 8/21 (38%)
C2H2 Zn finger 387..407 CDD:275368 8/19 (42%)
zf-H2C2_2 399..422 CDD:290200 10/22 (45%)
C2H2 Zn finger 415..436 CDD:275368 7/20 (35%)
C2H2 Zn finger 444..460 CDD:275368 3/15 (20%)
C2H2 Zn finger 492..512 CDD:275368 1/19 (5%)
C2H2 Zn finger 520..540 CDD:275368 0/19 (0%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 7/22 (32%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
CG17806NP_650658.1 zf-AD 4..76 CDD:285071 26/73 (36%)
zf-C2H2 260..282 CDD:278523 8/21 (38%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
C2H2 Zn finger 290..311 CDD:275368 7/20 (35%)
COG5048 <298..>383 CDD:227381 35/156 (22%)
C2H2 Zn finger 319..339 CDD:275368 8/67 (12%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
ZnF_U1 375..407 CDD:197732 9/27 (33%)
C2H2 Zn finger 378..396 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.