DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG31388

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:470 Identity:118/470 - (25%)
Similarity:192/470 - (40%) Gaps:88/470 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CRTCYNDFTAD-FRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREM 230
            ||||..  .|| ..||:||||::|.:|..||.::.:.:......||.||..|:..|..|||||.:
  Fly     5 CRTCSR--MADPAVAKNLFDPSSSSVLRQIETLTNLQLKEDGKLPRFMCQDCQHDLQIAIDFRRV 67

  Fly   231 CIST----ELKLSQ-----------AKPSTDEVQIEAENENPI---SSDHDLISDTE--NTNVEE 275
            ||..    ||:|.|           |:...|:...|..|.:|:   :...|.|.|.|  :.|.:|
  Fly    68 CIEAQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQDKNTDE 132

  Fly   276 IEDAGGDHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGA 340
            :..     ::...|::...:.::|.....||      .::..:::..|..|.           |.
  Fly   133 LAS-----IKTTTTTEYMNAYQSVASPQSSP------ELSTDSQLSNEHFDM-----------GL 175

  Fly   341 PIASKPKAKEKAAGEQKPKRSANPKTK---EERNL----IRRAQLRAKPPN--FVCDQCGQAFRM 396
            ...|:|   |..|.:.:...|::..:|   |..|:    :.:..|...||:  ||||.|.:.||.
  Fly   176 SPESEP---ESEAIDNRDTSSSHTCSKCGLEFENVDELKLHKYHLHDIPPDTKFVCDHCDEGFRS 237

  Fly   397 SHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFA----CGFCSETFAYPGAR 457
            :..|..|.........:.||:|...|::..:...|   :.|...|.|    |..|.         
  Fly   238 AAALTRHCNMINLPLTHSCTKCKSQFHNHILLETH---KQRCLRPPASQHVCHICG--------- 290

  Fly   458 QKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQ- 521
             ||.:...|....|:          :...:.|::|..|...:.:...|..|.|:||....|.|: 
  Fly   291 -KHLTTAFNLKNHLV----------RHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRY 344

  Fly   522 RCSKSYSDPNKLKRHEMTH---EKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFR 583
            .|.|::...:....||..|   .||..||:.|.|.:...:..|.|:..|...|.:.||:|.::|:
  Fly   345 NCGKTFRFCSARSMHERVHMDASKRIYQCEYCPKSYVTPSECRTHQKYHNLTRDHGCEICRISFK 409

  Fly   584 YKYNMKSHANSKMHQ 598
            ...:.:||..|..|:
  Fly   410 TAKHYRSHLKSNAHK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 32/77 (42%)
zf-C2H2 385..407 CDD:278523 9/21 (43%)
C2H2 Zn finger 387..407 CDD:275368 7/19 (37%)
zf-H2C2_2 399..422 CDD:290200 5/22 (23%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 2/15 (13%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 5/20 (25%)
C2H2 Zn finger 547..567 CDD:275368 5/19 (26%)
zf-met 574..597 CDD:289631 7/22 (32%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 29/72 (40%)
C2H2 Zn finger 228..254 CDD:275368 7/25 (28%)
C2H2 Zn finger 286..306 CDD:275368 6/39 (15%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..363 CDD:275368 5/20 (25%)
C2H2 Zn finger 373..393 CDD:275368 5/19 (26%)
C2H2 Zn finger 401..419 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.