DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and M1BP

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:502 Identity:108/502 - (21%)
Similarity:175/502 - (34%) Gaps:166/502 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMC 231
            ||.|.. :.::.|:..||:.:|:.::.:||.::|:.:.:....|..:|..|...|..|:..||.|
  Fly    13 CRVCAK-YASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRERC 76

  Fly   232 ISTELKL---------------------------SQAKPSTDEVQI---EAENENPISSDHDLIS 266
            |:.:.:|                           :...|..|||..   |...|.|.....|...
  Fly    77 IAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTKV 141

  Fly   267 DTENTNVEEIEDAGGDHVEDEATS------------DDQTSQEA----------VDEVAESPAAQ 309
            :.:||..|..|...|   ||:|.|            :|:..|:.          |.:|.::....
  Fly   142 EYDNTYYEVAEGHAG---EDDAASLIEEADYDSIMAEDEEQQQTLELDEDTELIVGDVNDAYVYD 203

  Fly   310 DPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIR 374
            ....||    :...:||.....|...::| ..:..|||.:...|                    |
  Fly   204 SDDEVA----VLDNVLDDEYEHENIVVKK-CSLPPKPKVRSDDA--------------------R 243

  Fly   375 RAQLRAKPPNFVCDQCGQAF--RMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHR 437
            |   |.....::|:|||...  ||:..|                              |.| |||
  Fly   244 R---RGTGGVYICEQCGNHIKGRMAFEL------------------------------HCR-RHR 274

  Fly   438 GETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASK 502
            |:..|.                                                |:|||..:.:.
  Fly   275 GDKQFG------------------------------------------------CELCQSRFCTT 291

  Fly   503 YALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH-EKRPLQCDVCLKGFYQRTRLREHELI 566
            ..|..|::.||....:.|:.|.:.::|.....:||.|| .:||..|..|.|.|.....|:.|.||
  Fly   292 SELKRHMRKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLI 356

  Fly   567 HTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARKLGVVQIVATE 613
            |:|||.|.||:|:.:|....::.:|..|.:|:.:..|..:.|::..|
  Fly   357 HSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVLEQE 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 20/99 (20%)
zf-C2H2 385..407 CDD:278523 7/23 (30%)
C2H2 Zn finger 387..407 CDD:275368 7/21 (33%)
zf-H2C2_2 399..422 CDD:290200 1/22 (5%)
C2H2 Zn finger 415..436 CDD:275368 2/20 (10%)
C2H2 Zn finger 444..460 CDD:275368 0/15 (0%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 6/22 (27%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/71 (27%)
C2H2 Zn finger 253..273 CDD:275368 9/50 (18%)
COG5048 276..>331 CDD:227381 16/102 (16%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 293..317 CDD:290200 6/23 (26%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
zf-H2C2_2 324..346 CDD:290200 10/21 (48%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
zf-H2C2_2 350..372 CDD:290200 12/21 (57%)
C2H2 Zn finger 365..383 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.