DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG8159

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:463 Identity:102/463 - (22%)
Similarity:165/463 - (35%) Gaps:144/463 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMC 231
            ||.|.:. |.:.::..||:.....:|..|.:::||.:..:|..|..||..|::.|..||.||:.|
  Fly     6 CRVCASS-TDNSKSLKLFNSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAISFRDRC 69

  Fly   232 ISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDT---------------ENTNVEEIEDAGG 281
            :.::....::....:|....:.......|......||               |:.:..:.||.|.
  Fly    70 LRSQKIFEESLVRNEEDTFRSSVRRSARSQRQRHEDTAPKTPASPLEVMIKLESLSNGDEEDDGI 134

  Fly   282 DHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKP 346
            ||::....:|.:.:.:|:....|......|:.:                  |...|:|       
  Fly   135 DHLDSCNEADMELAIKAMSSSTEDDGTTSPVRL------------------KRTRRRG------- 174

  Fly   347 KAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTK 411
             .|:...||.:.|.:.                    |.|.|||||      :|:           
  Fly   175 -LKKGGKGENRTKVTL--------------------PVFFCDQCG------NNI----------- 201

  Fly   412 NYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRI 476
                  ..|:.:|.::|      :|.|..||                                  
  Fly   202 ------TGKSSFDRHLR------KHSGIRPF---------------------------------- 220

  Fly   477 NPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH- 540
                          ||:||...:.|...|..|...||....::|:.|.::|.:.:...|||.|| 
  Fly   221 --------------QCELCPARFLSSGELKGHQVMHTGDRKFQCRYCDRTYVNYSGRLRHERTHT 271

  Fly   541 EKRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARK-- 603
            ..||..|..|.|.|.....|:.|.|||||||.:.||:|:.:|....::|:|..|..|:.|..|  
  Fly   272 NDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARPTHLKTHFRSNTHKHNLEKSM 336

  Fly   604 --LGVVQI 609
              .|.||:
  Fly   337 ADAGGVQL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 21/72 (29%)
zf-C2H2 385..407 CDD:278523 7/21 (33%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..422 CDD:290200 2/22 (9%)
C2H2 Zn finger 415..436 CDD:275368 3/20 (15%)
C2H2 Zn finger 444..460 CDD:275368 0/15 (0%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 6/19 (32%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 7/22 (32%)
C2H2 Zn finger 575..591 CDD:275368 5/15 (33%)
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 21/72 (29%)
C2H2 Zn finger 194..214 CDD:275368 9/48 (19%)
COG5048 <197..322 CDD:227381 47/201 (23%)
zf-H2C2_2 206..231 CDD:290200 10/78 (13%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
C2H2 Zn finger 250..270 CDD:275368 6/19 (32%)
zf-H2C2_2 265..287 CDD:290200 11/21 (52%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-H2C2_2 291..315 CDD:290200 13/23 (57%)
C2H2 Zn finger 306..328 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.