DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and Zif

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001189188.1 Gene:Zif / 40795 FlyBaseID:FBgn0037446 Length:388 Species:Drosophila melanogaster


Alignment Length:490 Identity:113/490 - (23%)
Similarity:188/490 - (38%) Gaps:141/490 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 MELDP------LSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPD 208
            :||.|      |:..|:|:.|.:.|            ::..:..|.:|:    .:.||..|:..|
  Fly     3 VELTPQTCRVCLAQSERLQRLDEIR------------EEGEESPNEMLI----QLLGVSYSNLND 51

  Fly   209 E---PRLMCPACKSALDQAIDFREMCISTELKLSQ------AKPSTDEVQIEAENENPISSDHD- 263
            .   |..:|.:||..|:.|..|||..:..::::.:      ....:|.:.|:.|:.:....|.: 
  Fly    52 REHIPDGICKSCKVELNMAYQFREKALRKQMEIEEYCRELGLLDESDVMMIKEEDGSQQQCDEEM 116

  Fly   264 -LISDTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVALGA---KIFKEL 324
             ::.:|.....|..|:.|.:...:..|||   .||.:.:..|  ..:|..::.:.:   :|..|.
  Fly   117 YILEETTTGEEEHQEEKGHEEYLEVDTSD---QQECIGDTIE--YLEDNYTIEMNSDQTEIVLES 176

  Fly   325 LDQY--TGKEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVC 387
            ..||  |..::..|::.|      ||..||. ..:.:|..|..|..:         ..:...::|
  Fly   177 EKQYEETPSQQLALQEAA------KASLKAR-RGRVRRGLNSLTTSD---------GTEKGGYIC 225

  Fly   388 DQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFA 452
            |.||                             .||:...|.|..|.||.       |.|     
  Fly   226 DVCG-----------------------------NFYEKRGRMMEHRRRHD-------GIC----- 249

  Fly   453 YPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANA 517
                                                :|.|:||...:..:..|..|:.|||.:..
  Fly   250 ------------------------------------QYACELCDAKFQVREQLRKHMYSHTGSKP 278

  Fly   518 YKCQRCSKSYSDPNKLKRHEMTHEK-RPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVN 581
            |||..||:.:...:.||.||..|.. :|..|.||.|.|.....|.:|||||:..:.|.|:.||.:
  Fly   279 YKCSFCSRQFFYESVLKSHENVHRGIKPYVCKVCDKAFAYAHSLTKHELIHSDIKLYRCDYCNKD 343

  Fly   582 FRYKYNMKSHANSKMHQDNARKLG---VVQIVATE 613
            ||..::|:.|..:|:|| ||..|.   .|::||.:
  Fly   344 FRLLHHMRQHEETKLHQ-NAVMLAESMKVEMVAEQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 16/75 (21%)
zf-C2H2 385..407 CDD:278523 4/21 (19%)
C2H2 Zn finger 387..407 CDD:275368 4/19 (21%)
zf-H2C2_2 399..422 CDD:290200 0/22 (0%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 2/15 (13%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 7/19 (37%)
C2H2 Zn finger 547..567 CDD:275368 9/19 (47%)
zf-met 574..597 CDD:289631 8/22 (36%)
C2H2 Zn finger 575..591 CDD:275368 6/15 (40%)
ZifNP_001189188.1 zf-AD 9..87 CDD:285071 20/93 (22%)
C2H2 Zn finger 225..245 CDD:275368 9/48 (19%)
COG5048 <250..369 CDD:227381 45/119 (38%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
zf-H2C2_2 266..288 CDD:290200 10/21 (48%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 294..318 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 9/19 (47%)
C2H2 Zn finger 337..353 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.