DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and Phs

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster


Alignment Length:688 Identity:146/688 - (21%)
Similarity:241/688 - (35%) Gaps:199/688 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ICIEHFKDEDIEGSLK----------------------FEMGLAKKRTLRPGAVPCVN------- 94
            |...||:.|.:|.|.:                      .|||..|         ||..       
  Fly   172 ILSRHFQLEHVEKSKRKRGKTKAAAEEPMVTPPLIIDPLEMGQLK---------PCAQLLVQGES 227

  Fly    95 --------KSQESGSDRARKERSQRRRNQELVAELLAEEE-------AKLIHPEATSFEQDSVYL 144
                    .||.....|.::..||:....:|   |:.:||       |.:..|.|.:..:.:..|
  Fly   228 VLQLCLACNSQFVDVVRFQEHLSQQHGYFQL---LVPKEEPTDLPPHAMVTIPGALALNKANAQL 289

  Fly   145 S------ETVTMELD-----PLSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVI 198
            .      ||...|.|     |.:.....|:|    |..||..|...|:.:...::|.:   .::|
  Fly   290 QLPIPAPETPPPEQDGKEAPPSNASNDKEDL----TMINDMVAVIAAERVKKTSSSKV---NKMI 347

  Fly   199 SGVWISHKPDEPRLMCPACKSALDQA--IDFREMCISTE-----LKLSQAKPSTDEVQIEAENEN 256
            ..:.:..|....|....:.:...|.|  .|.::.....|     |:..|||.::::.:..|...|
  Fly   348 IKLPMPKKRGRKRTKPESLRDEQDNAEKTDKKKKLNKEEGQQPVLEPLQAKKTSNQAENGATQSN 412

  Fly   257 PI----------SSDHDLISDTENTNVEEIEDA---GGDHVE---------------DEA----- 288
            .:          ..|....:....||.:.:|:|   ..|:.|               |||     
  Fly   413 NVVKVQQNAKGSKKDGTQSAQKSETNPKHLENAETNSKDNTESVALKETIHDKQLTIDEAGKAGT 477

  Fly   289 TSDDQTSQEAVDEVAESPAA----------QDPLSVALGAKIFKELLDQYTGKEKARL----RKG 339
            ..||.::|:.:|: :|:.|.          |.|:.   .||..:::.::.|...|.:.    ||.
  Fly   478 QKDDNSNQKQLDK-SEANAGKSKMVDQVHQQMPVE---SAKDHQQMTEEPTNSTKRKRGRKERKS 538

  Fly   340 -----APIASKPKAKEKAAGEQKPKRSA-----------------------------------NP 364
                 .|:..|...:|....|::.::|.                                   |.
  Fly   539 PTPVLIPLGDKEIKEEPELPERRMRKSRQHVDYVVEIKDEEEDDDEVEEAEVDDDSSATISPHNS 603

  Fly   365 KTKEERNLIRRAQLRAKPPNFV-----CDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYD 424
            .|.|....|:|........|.:     |:.||:.|:....::.|:..||..|.|.|.:|.:.| .
  Fly   604 STDESFTSIKRESSEESQHNGIGGIHTCNFCGKTFKRFSRMQDHLRLHTGEKPYVCGQCGRAF-R 667

  Fly   425 AYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVR 489
            ..||.:..::|||.|..:.|..||...|     .|.:..:|               |...:...|
  Fly   668 LKMRLVEHQLRHRAEKAYKCDICSMPLA-----TKQDLSLH---------------MRHHKNDRR 712

  Fly   490 YQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH-EKRPLQCDVCLKG 553
            |:|..|.|.:.....|..|::.||....|.|..|.|::.....|..|..|| ..:|:||::|.|.
  Fly   713 YKCDKCNKGFVRSSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVHRRTHLGDKPIQCELCDKR 777

  Fly   554 FYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSH 591
            |.::..:|.|...||||:||.|:.|...:..:.|:..|
  Fly   778 FARKIDMRVHMRRHTGEKPYNCDACQRGYSSRVNLLRH 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 12/73 (16%)
zf-AD 167..240 CDD:214871 14/79 (18%)
zf-C2H2 385..407 CDD:278523 5/26 (19%)
C2H2 Zn finger 387..407 CDD:275368 5/19 (26%)
zf-H2C2_2 399..422 CDD:290200 7/22 (32%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 6/19 (32%)
zf-met 574..597 CDD:289631 4/18 (22%)
C2H2 Zn finger 575..591 CDD:275368 3/15 (20%)
PhsNP_648789.3 COG5048 <594..787 CDD:227381 55/213 (26%)
C2H2 Zn finger 631..651 CDD:275368 5/19 (26%)
zf-H2C2_2 644..666 CDD:290200 7/21 (33%)
zf-H2C2_2 699..724 CDD:290200 7/39 (18%)
zf-C2H2 713..735 CDD:278523 6/21 (29%)
C2H2 Zn finger 715..735 CDD:275368 5/19 (26%)
zf-H2C2_2 727..750 CDD:290200 8/22 (36%)
C2H2 Zn finger 743..763 CDD:275368 5/19 (26%)
zf-H2C2_2 755..780 CDD:290200 10/24 (42%)
C2H2 Zn finger 771..791 CDD:275368 6/19 (32%)
zf-H2C2_2 783..808 CDD:290200 10/24 (42%)
C2H2 Zn finger 799..816 CDD:275370 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.