DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG17359

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:452 Identity:97/452 - (21%)
Similarity:158/452 - (34%) Gaps:142/452 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 QKCRTCYND-------FTADFRAKDLFDPANSVLLFHIEVISGVWISHKPD-EPRLMCPACKSAL 221
            |.||.|.::       :|..:.:.:.......||...:...||..: ||.| .|:.:|..|..|:
  Fly     5 QMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSV-HKEDGMPQFICVECAEAV 68

  Fly   222 DQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTEN-TNVEEIEDAGGDHVE 285
            ..|...|..|..:.....|.:....|                 :.|.|. .|:       ||::|
  Fly    69 RNAYRLRRQCRKSHQYFEQLRLMMKE-----------------LDDIEYCLNI-------GDNIE 109

  Fly   286 DEATSDDQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKE 350
            .:       ...:|.|..::|...:||.|                 |..:::...|         
  Fly   110 PQ-------MPVSVMEAGKTPETSEPLLV-----------------ELVQVKYMPP--------- 141

  Fly   351 KAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQC 415
                |.||..|..|...|.:  :.::...||.|                   |.....|.::|  
  Fly   142 ----EPKPISSPLPDNNEHK--LAQSYSPAKTP-------------------HNKSKRRARSY-- 179

  Fly   416 TECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAY-PGARQKHESE--VHNAAPRLIVKRIN 477
                                            |:..:: |.:..:||.:  :.||:     ||..
  Fly   180 --------------------------------SDNDSWSPDSELEHEDDDKIWNAS-----KRGK 207

  Fly   478 PKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE- 541
            ||.:|.|     |:||||.:.:..|..|..|::.||....|||..|.:|::....|:.|...|. 
  Fly   208 PKRVPGP-----YRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTG 267

  Fly   542 KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARK 603
            :||..|..|.|.|.|..:|:.|...||||:|:.|..|..:|:....::.|.::  |....|:
  Fly   268 ERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSA--HTRGKRR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 18/80 (23%)
zf-C2H2 385..407 CDD:278523 1/21 (5%)
C2H2 Zn finger 387..407 CDD:275368 1/19 (5%)
zf-H2C2_2 399..422 CDD:290200 3/22 (14%)
C2H2 Zn finger 415..436 CDD:275368 0/20 (0%)
C2H2 Zn finger 444..460 CDD:275368 2/16 (13%)
C2H2 Zn finger 492..512 CDD:275368 7/19 (37%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 7/19 (37%)
zf-met 574..597 CDD:289631 4/22 (18%)
C2H2 Zn finger 575..591 CDD:275368 3/15 (20%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 18/82 (22%)
zf-C2H2 215..237 CDD:278523 8/21 (38%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 9/24 (38%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 286..310 CDD:290200 10/23 (43%)
C2H2 Zn finger 301..321 CDD:275368 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.