DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG14135

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:118/310 - (38%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRCAVPNCRNFSDCRSKRNAAQQQRLGFFRFPKCPDTFKAWLAFCGYTEESLKLKNPCICIEHFK 65
            |||||.||.|      ....|.:.:..:|.|||.....:.|:.||  ..:::.....|||.|||.
  Fly     1 MRCAVKNCGN------NNRIANRTKWRYFHFPKEKPNLQRWIDFC--QRDNINPTTACICNEHFA 57

  Fly    66 DEDIEGSLKFEMGLAKKR--TLRPGAVPCVNKSQESGSDRARKERSQRRRNQELVAELLAEEEAK 128
            ..|.|.::::|:|.::|.  .|:||:.|.||..|:    .|::.|...:|..:.|          
  Fly    58 PNDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQK----LAKELRGSIKRGSKSV---------- 108

  Fly   129 LIHPEATSFEQDSVYLSETVTMELDP-------LSGEEKLEELQKCRTCYNDFTADF----RAKD 182
               |.|.|.:..::        ..||       ..|.|.: |:|.|     .|..|.    .|:|
  Fly   109 ---PLAGSTKMSNI--------GFDPHHAGTQSSEGHETI-EIQLC-----GFNTDIEGFEEAED 156

  Fly   183 -------------LFDPAN--SVLLFHIEVISG---VWISHKPDEPRLMCPACKSALDQAIDFRE 229
                         :.||.|  |....|:|:|..   .::.|      |....|  :|.:.:.|  
  Fly   157 DDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEGDSYVKH------LELEIC--SLKREVFF-- 211

  Fly   230 MCISTELKLSQAKPSTDEVQ-IEAENENPISSDHDLISDTENTNVEEIED 278
                  ||        ||.| |:||..|        :.||...:.||:.:
  Fly   212 ------LK--------DEYQKIKAEMRN--------LKDTIKRSEEELAE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 32/95 (34%)
zf-AD 167..240 CDD:214871 19/94 (20%)
zf-C2H2 385..407 CDD:278523
C2H2 Zn finger 387..407 CDD:275368
zf-H2C2_2 399..422 CDD:290200
C2H2 Zn finger 415..436 CDD:275368
C2H2 Zn finger 444..460 CDD:275368
C2H2 Zn finger 492..512 CDD:275368
C2H2 Zn finger 520..540 CDD:275368
C2H2 Zn finger 547..567 CDD:275368
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
CG14135NP_001261721.1 THAP 2..88 CDD:283206 30/93 (32%)
GrpE 198..>239 CDD:295646 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11471
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.