DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG1663

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_610521.1 Gene:CG1663 / 36012 FlyBaseID:FBgn0033449 Length:387 Species:Drosophila melanogaster


Alignment Length:378 Identity:83/378 - (21%)
Similarity:126/378 - (33%) Gaps:71/378 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 DEVQIEAEN--ENPISSDHDLISDTEN-TNVEEIEDAGGDHV--EDEATSDDQTSQEAVDEVAES 305
            ||||:|..|  ...|:.:..|....|: .|||.:|:....:.  |.|...|:..|....|.::..
  Fly    23 DEVQVEMTNLLAASIAQESKLAEVQESFKNVEFMEEEVEPNFSPEKEQGHDELASNSHHDYISNQ 87

  Fly   306 PAAQDPLSVALGAKIFKELLDQYTGK-----EKARLRKGAPIASKPKAKEKAAGEQKPKRSANPK 365
            |           .|.|..|.....|.     ::.|..|...|......|       |.:..::.|
  Fly    88 P-----------HKAFYSLQRTSPGVIQYFIQQLRRHKFFWITEHGINK-------KDRMDSSQK 134

  Fly   366 TKEERNLIRRAQLRAKPP---------------NFVCDQCGQAFRMSHNLRIHMLRHTRTKNY-- 413
            ..|.  |..|...:..|.               .:|.......||..:....|.|......|:  
  Fly   135 VAEA--LFHRFHFQLDPKVVNASARFLQVWFERQYVMQLSSSDFRCRYPKYYHSLLKFMPTNHIS 197

  Fly   414 --QCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRI 476
              .|.||.:.|.:..:..:|....|.|..|..|..|.::|......::|::..|...|       
  Fly   198 VTICEECDRRFLNERLLRLHKFRVHGGPNPNVCHVCHQSFPLASKLEQHQARYHFKRP------- 255

  Fly   477 NPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE 541
                        .:||..|..:..||:....|...|.....|.|:.|..|....:.|..|..||:
  Fly   256 ------------EWQCSRCDYNAPSKWDFQQHQAMHAGQRNYICELCGHSSKTSSALAVHRRTHD 308

  Fly   542 KRPLQCDVCLKGFYQRTRLREH-ELIHTGE--RPYWCEVCNVNFRYKYNMKSH 591
            :..|.|..|.:.|.:.:.|:.| ..||.|.  |...|:.|...|:....:|.|
  Fly   309 QPKLCCPHCSRQFRENSTLKSHIRKIHDGNSARQVSCDFCWRRFKTLELLKLH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 5/21 (24%)
C2H2 Zn finger 387..407 CDD:275368 4/19 (21%)
zf-H2C2_2 399..422 CDD:290200 6/26 (23%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 3/15 (20%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 5/20 (25%)
zf-met 574..597 CDD:289631 5/18 (28%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
CG1663NP_610521.1 MttA_Hcf106 <33..>91 CDD:294511 13/68 (19%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 259..279 CDD:275368 5/19 (26%)
C2H2 Zn finger 287..307 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..335 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3304
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.