DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG18262

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:430 Identity:106/430 - (24%)
Similarity:161/430 - (37%) Gaps:109/430 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 CKSALDQ---AIDFREMCISTELKLSQAKPSTDEVQIEAE--NENPISSDHDLISDTENTNVEEI 276
            |.:.|:.   |.|..|:..:.||....||.::.:::.|.|  .|......:...:..:||.||..
  Fly    63 CSNELESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETR 127

  Fly   277 ED--------AGGDHVEDEATSDDQTSQEAVDEVAESPAAQDPL--------------------- 312
            ||        .||:..|...|.:::..:...|:..:|...:|.|                     
  Fly   128 EDLLDIELDWTGGEQSEHNETHEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRR 192

  Fly   313 ---SVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIR 374
               |.|.|..     ||:...:..::.|||.|  ...|..|:|         .|...:.||:|  
  Fly   193 LKHSEANGGS-----LDKSASERNSKKRKGPP--KVYKCNEEA---------CNQTFRTERDL-- 239

  Fly   375 RAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGE 439
            |.. |.|.....||.||:.|..|.|:..|..||:..|.::|.||..|||.....:.| .|.|.|.
  Fly   240 RGH-RWKHTGIFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSH-SICHTGR 302

  Fly   440 TPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKYA 504
            .|..|..|.                                  :|       |:       .:..
  Fly   303 MPCICEVCG----------------------------------RP-------CR-------DRGV 319

  Fly   505 LGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEK-RPLQCDVCLKGFYQRTRLREHELIHT 568
            |..|::.||.....||:.|.|::...:.|..|.::|.. ||..||||...|.::..||.|:|:|:
  Fly   320 LTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHS 384

  Fly   569 GERPYWCEVCNVNFRYKYNMKSHANSKMHQDNARKLGVVQ 608
            .:|.|.|::|...|.....:.:|..|   .|.||..|.|:
  Fly   385 EQRKYACKLCGKTFAQSGGLNAHMRS---HDPARVKGAVK 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 7/25 (28%)
zf-C2H2 385..407 CDD:278523 8/21 (38%)
C2H2 Zn finger 387..407 CDD:275368 8/19 (42%)
zf-H2C2_2 399..422 CDD:290200 8/22 (36%)
C2H2 Zn finger 415..436 CDD:275368 8/20 (40%)
C2H2 Zn finger 444..460 CDD:275368 2/15 (13%)
C2H2 Zn finger 492..512 CDD:275368 3/19 (16%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 9/19 (47%)
zf-met 574..597 CDD:289631 5/22 (23%)
C2H2 Zn finger 575..591 CDD:275368 3/15 (20%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 8/33 (24%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
COG5048 <256..415 CDD:227381 53/210 (25%)
zf-H2C2_2 263..288 CDD:290200 10/24 (42%)
C2H2 Zn finger 279..327 CDD:275368 17/96 (18%)
zf-H2C2_2 320..342 CDD:290200 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
zf-C2H2 389..411 CDD:278523 6/24 (25%)
C2H2 Zn finger 391..411 CDD:275368 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.