DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and CG10959

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:627 Identity:129/627 - (20%)
Similarity:205/627 - (32%) Gaps:243/627 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NAAQQQRLGFFRFPKCPDTFKAWLAFCGYTEESLKLKNPC-IC-IEHFKDEDIEGSLKFEMGLAK 81
            :|.||.|      |||.:.|        |..|:.:.:..| :| ::||..||.            
  Fly    15 HAQQQLR------PKCGEIF--------YEPEANRFQLVCLLCDMKHFGFEDF------------ 53

  Fly    82 KRTLRPGAVPCVNKSQESGSDRARKERSQRRRNQELVAELLAEEEAKLIHPEATSFEQDSVYLSE 146
                                  ||..|:                    :|     |::....|::
  Fly    54 ----------------------ARHIRN--------------------VH-----FDKQGRPLTK 71

  Fly   147 TVTMELDPLSGEEKLEELQKCRTCYNDFTADFRAKDLFDPANSVLLFHIEVISGVWISHKPDEPR 211
            ||| .|..|:.||  :|.|                                  ||          
  Fly    72 TVT-GLGRLAREE--QEFQ----------------------------------GV---------- 89

  Fly   212 LMCPACKSALDQAID-FREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENTNVEE 275
                   ||...|:| |::..:..|..||:.:.:..|:.:|.:..||:                .
  Fly    90 -------SAEPLAVDSFKKEYLPNEDVLSEEEDAEQELGLEQDEGNPL----------------R 131

  Fly   276 IEDAGGDHVEDEATSD-----DQTSQEAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKAR 335
            |...||....||.|.|     |..|..|              ||..|.                 
  Fly   132 IMVLGGKQSVDEETIDTMWQPDHDSSSA--------------SVNEGC----------------- 165

  Fly   336 LRKGAPIASKPKAKEKAAGEQKPKRSANPKTKEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNL 400
                        |.|...|.:.|:.....:..||...:.:.|  .:|.::.|..|.:.:.....|
  Fly   166 ------------ALEALLGVENPQDYQPDEDGEEHQSVFKKQ--RQPKDYNCPHCDRRYTTQKYL 216

  Fly   401 RIHM-LRHTRTKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETF-----------AY 453
            ..|: :.|...:.::|.:|..||........|.|..|   |.|||..|.:.|           .:
  Fly   217 NTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEH---TEFACQLCDKVFKSSRSLLRHVQGH 278

  Fly   454 PGARQ---KHES------EVHNAAPRLIVKRINPKPMPKPRESVRYQCKLCQKHYASKY--ALGW 507
            .|||.   :||:      ..||....   :|::       .|...|.|:||  .|.|:|  ||..
  Fly   279 SGARTFKCEHENCGKSFVNQHNLTSH---RRVH-------SEERNYVCELC--GYRSRYREALIV 331

  Fly   508 HIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGER 571
            |.::||....::||.|::.::..:.|..|:..|. ::|.:||.|...|.:...|..|:.:|.|.:
  Fly   332 HRRTHTGEKPFQCQTCARRFASKSLLNEHQAMHSTEKPYKCDKCDSAFSRPKALYHHKHLHLGIK 396

  Fly   572 PYWCEVCNVNFRYKYNMKSHANSKMHQDNARKLGVVQIVATE 613
            .:.|::|...:.....:.:|.       .|.|| ...:.|||
  Fly   397 KFKCKICGNAYAQAAGLSAHM-------RAHKL-QASVNATE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 16/78 (21%)
zf-AD 167..240 CDD:214871 9/73 (12%)
zf-C2H2 385..407 CDD:278523 4/22 (18%)
C2H2 Zn finger 387..407 CDD:275368 4/20 (20%)
zf-H2C2_2 399..422 CDD:290200 5/23 (22%)
C2H2 Zn finger 415..436 CDD:275368 6/20 (30%)
C2H2 Zn finger 444..460 CDD:275368 6/29 (21%)
C2H2 Zn finger 492..512 CDD:275368 9/21 (43%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 6/19 (32%)
zf-met 574..597 CDD:289631 3/22 (14%)
C2H2 Zn finger 575..591 CDD:275368 2/15 (13%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 6/20 (30%)
COG5048 <258..416 CDD:227381 41/169 (24%)
C2H2 Zn finger 258..278 CDD:275368 3/19 (16%)
C2H2 Zn finger 289..308 CDD:275368 4/21 (19%)
C2H2 Zn finger 316..336 CDD:275368 9/21 (43%)
zf-H2C2_2 328..353 CDD:290200 8/24 (33%)
C2H2 Zn finger 344..364 CDD:275368 5/19 (26%)
zf-H2C2_2 357..381 CDD:290200 8/23 (35%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..420 CDD:275368 3/26 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.