DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and Zfp574

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:XP_038967305.1 Gene:Zfp574 / 308434 RGDID:1311420 Length:909 Species:Rattus norvegicus


Alignment Length:743 Identity:155/743 - (20%)
Similarity:243/743 - (32%) Gaps:246/743 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EMGLAKKRT-LR--PGAVPC-------VNKSQESGSDRARKERSQRRRNQ--------------E 116
            ||.|:.::| ||  |...|.       |......|..|...|.|.|:..:              |
  Rat   150 EMWLSHRQTHLRATPNKAPAPVVLGSPVVLGPPVGQARVAVEHSYRKAEEGGEGAAVPSVAAATE 214

  Fly   117 LVAEL------------LAEEEAKLIHPEATSF------------EQDSVYLS--ETVTMELDPL 155
            :|.|:            |.:..|..:..:||.|            :|:::..|  |....:.|||
  Rat   215 MVTEVELLLYKCSECSQLFQMPADFLEHQATHFPAPVPEAEEPATQQETLVPSPTEAAVSQPDPL 279

  Fly   156 SGEEKLEELQK--------------------------------CRTCYNDFTADFRAKDLFDPAN 188
            ...:...||:.                                |..|...|.:..:.:.      
  Rat   280 PASDHSYELRNELRNGEAMGRDRRGRKPRRSSSGESGATQELFCSACDQIFLSPHQLQQ------ 338

  Fly   189 SVLLFHIEVISGVWISHKPDEPRLMCPACK------SALDQAI-----DFREMCISTELKLSQAK 242
                 |:.       ||:  |....||.|.      |:|||.:     :...:|:...|..    
  Rat   339 -----HLR-------SHR--EGVFKCPLCSRVFPSPSSLDQHLGDHSSESHFLCVDCGLAF---- 385

  Fly   243 PSTDEVQI---EAENENPISS---DHDLISDTENTNVEEIEDAGGDHV-------EDEATSDDQT 294
             .|:.:.:   .|...||:.|   ....::.|:.........|||..:       |:.|.|..:.
  Rat   386 -GTEALLLAHRRAHTPNPLHSCPCGKTFVNLTKFLYHRRTHGAGGVPLPTTPVPPEEPAISFPEP 449

  Fly   295 SQEAV-----------DEVAESPAAQDPLSVALGAKIFKELLDQYTG------------------ 330
            :....           :|.:..|||.......|.::.|.:.| |.|.                  
  Rat   450 APAETGELEAPELPVSEESSAEPAAPGTYRCLLCSREFSKAL-QLTRHQRFVHRLERRHKCSICG 513

  Fly   331 ---KEKARLRK-----------GAPIASKP--------KAKEKAAGEQKPKRSAN-PKTKEERNL 372
               |:|:.:|.           ..|..|||        :.:....|| :|.|..: .|...:.:.
  Rat   514 KMFKKKSHVRNHLRTHTGERPFPCPDCSKPFNSPANLARHRLTHTGE-RPYRCGDCGKAFTQSST 577

  Fly   373 IRRAQL-RAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRNMHIRIRH 436
            :|:.:| .|:...:.|.:||..|...:.|.:|...||....|:|.|||::|....:..:|..:.|
  Rat   578 LRQHRLVHAQHFPYRCQECGVRFHRPYRLLMHRYHHTGEYPYKCRECPRSFLLRRLLEVHQLVVH 642

  Fly   437 RGETP-------------------------------FACGFCSETFAYPGARQKHESEVHNAAPR 470
            .|..|                               |.||.|.:........|.||:....|.|.
  Rat   643 AGRQPHRCPSCGAAFPSSLRLREHRCAAAAAQAPRRFECGTCGKKVGSAARLQAHEAAHAAAGPG 707

  Fly   471 LIVKRINPKP----------MPKP----------------RESVRYQCKLCQKHYASKYALGWHI 509
            .::.:..|.|          .|.|                |..:  :|..|:|.::::.:|..|.
  Rat   708 EVLAKEPPAPRAARATRTPVAPSPTALGGTTSAAPAAPARRRGL--ECSECKKLFSTETSLQVHR 770

  Fly   510 KSHTDANAYKCQRCSKSYSDPNKLKRHEMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPY 573
            :.||....|.|..|.|::.....||.|...|. :||..|:||.|.|....||.||..||||||||
  Rat   771 RIHTGERPYPCPDCGKAFRQSTHLKDHRRLHTGERPFACEVCGKAFAISMRLAEHRRIHTGERPY 835

  Fly   574 WCEVCNVNFRYKYNMKSHANSKMHQDNA 601
            .|..|..::|...|:..|..:...|..|
  Rat   836 SCPDCGKSYRSFSNLWKHRKTHQQQHQA 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206 9/29 (31%)
zf-AD 167..240 CDD:214871 16/83 (19%)
zf-C2H2 385..407 CDD:278523 6/21 (29%)
C2H2 Zn finger 387..407 CDD:275368 6/19 (32%)
zf-H2C2_2 399..422 CDD:290200 9/22 (41%)
C2H2 Zn finger 415..436 CDD:275368 6/20 (30%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 6/19 (32%)
C2H2 Zn finger 547..567 CDD:275368 9/19 (47%)
zf-met 574..597 CDD:289631 5/22 (23%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
Zfp574XP_038967305.1 zf-C2H2_8 323..402 CDD:406359 18/103 (17%)
C2H2 Zn finger 323..343 CDD:275368 4/37 (11%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
C2H2 Zn finger 378..398 CDD:275368 3/24 (13%)
C2H2 Zn finger 406..425 CDD:275368 1/18 (6%)
lambda-1 469..>503 CDD:212564 8/34 (24%)
C2H2 Zn finger 480..501 CDD:275368 5/21 (24%)
COG5048 507..861 CDD:227381 86/356 (24%)
C2H2 Zn finger 509..529 CDD:275368 3/19 (16%)
C2H2 Zn finger 537..557 CDD:275368 4/19 (21%)
C2H2 Zn finger 565..585 CDD:275368 3/19 (16%)
C2H2 Zn finger 593..613 CDD:275368 6/19 (32%)
C2H2 Zn finger 621..642 CDD:275368 6/20 (30%)
C2H2 Zn finger 650..667 CDD:275368 0/16 (0%)
C2H2 Zn finger 753..773 CDD:275368 5/19 (26%)
C2H2 Zn finger 781..801 CDD:275368 6/19 (32%)
C2H2 Zn finger 809..829 CDD:275368 9/19 (47%)
C2H2 Zn finger 837..857 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.