DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and ZNF281

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001268222.1 Gene:ZNF281 / 23528 HGNCID:13075 Length:895 Species:Homo sapiens


Alignment Length:326 Identity:75/326 - (23%)
Similarity:121/326 - (37%) Gaps:84/326 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LKLSQAKPSTDEVQIEAENENPISSDH--DLISDTENTNVEEIEDAGGDH--VEDEATSDDQTSQ 296
            :.:.|.||:..|   |.::.:.....|  .|.:..|..:.......||.|  ::|.:.......|
Human   125 VSIKQEKPADPE---EQQSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQ 186

  Fly   297 EAVDEVAESPAAQDPLSVALGAKIFKELLDQYTGKEKARLRKGAPIASKPKAKEKA-AGEQKPKR 360
            :         .||....|.|.:   ....|.:.|.|:.:.......|.:||.:.:. ..::||..
Human   187 Q---------PAQHHRDVLLSS---SSRTDDHHGTEEPKQDTNVKKAKRPKPESQGIKAKRKPSA 239

  Fly   361 SANPKT--KEERNLIRRAQLRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFY 423
            |:.|..  ..|..::..:|   ||  .:||.|..|||.|::||.|:|.||..:.:||::|...|.
Human   240 SSKPSLVGDGEGAILSPSQ---KP--HICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFI 299

  Fly   424 DAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPKPMPKPRESV 488
            ..|:...|.:| |..|.||.|..||..|                                     
Human   300 QKYLLQRHEKI-HSREKPFGCDQCSMKF------------------------------------- 326

  Fly   489 RYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTHEKRPLQC-DVCLK 552
                       ..||.:..|.::|:....|||..|.:.:|..::|.:|..|       | :|.:|
Human   327 -----------IQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHRRT-------CGEVIVK 373

  Fly   553 G 553
            |
Human   374 G 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 0/3 (0%)
zf-C2H2 385..407 CDD:278523 11/21 (52%)
C2H2 Zn finger 387..407 CDD:275368 11/19 (58%)
zf-H2C2_2 399..422 CDD:290200 9/22 (41%)
C2H2 Zn finger 415..436 CDD:275368 6/20 (30%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 3/19 (16%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 4/8 (50%)
zf-met 574..597 CDD:289631
C2H2 Zn finger 575..591 CDD:275368
ZNF281NP_001268222.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..113
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..149 4/21 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..253 16/81 (20%)
C2H2 Zn finger 263..283 CDD:275368 11/19 (58%)
zf-H2C2_2 275..300 CDD:316026 10/24 (42%)
C2H2 Zn finger 291..311 CDD:275368 6/20 (30%)
zf-H2C2_2 304..328 CDD:316026 10/72 (14%)
C2H2 Zn finger 319..339 CDD:275368 7/67 (10%)
zf-H2C2_2 331..356 CDD:316026 6/24 (25%)
C2H2 Zn finger 347..366 CDD:275368 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..660
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 778..817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.