DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and tra-4

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001370327.1 Gene:tra-4 / 180575 WormBaseID:WBGene00018740 Length:543 Species:Caenorhabditis elegans


Alignment Length:462 Identity:88/462 - (19%)
Similarity:149/462 - (32%) Gaps:160/462 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 ENENPISSDHDLIS--DTENTNVEEIEDAGGDHVEDEATSDDQTSQEAVDEVAESPAAQDPLSVA 315
            ::|..:::..|||.  :||.|.:.|      |.:.|:...||.      ||..:.....:.|:.|
 Worm    64 DDEMDLNNKTDLIPLLETEKTTINE------DELYDDEEDDDD------DEEIKKGIGFELLAQA 116

  Fly   316 LGAKIFKELLDQYTGKEKARL------RKGAPIASKPKAKEKAAGEQKPKRSANP------KTKE 368
            ||......:..:...||:|:|      .|......||..||:...::...|..:|      :..|
 Worm   117 LGMSAKVPVEKEEPEKERAKLSGVGEFMKQIRGEIKPIQKERIVLDELGFRVRDPSKFPPCRIAE 181

  Fly   369 ERNLIRRAQ----LRAKPPNFVCDQCGQAFRMSHNLRIHMLRHTRTKNYQCTECPKTFYDAYMRN 429
            .:..:..|.    :...|||...|           :|| :.:..|.|..:|.:|...|.:..:..
 Worm   182 VQQTLTLADHQDGIDLPPPNAPTD-----------VRI-VRKLIRQKMVRCKKCKNRFIEKNIYE 234

  Fly   430 MHIRIRHRGETPFACGFCSETFAYPGARQKHESEVH-NAAPRLIVKRI----------------- 476
            .|:|.:|..             .|....::.|.||. .....:...||                 
 Worm   235 RHLRDKHPD-------------LYEEYIREQEEEVELQRLEEIEANRIEELQTGGFIPPENEISQ 286

  Fly   477 ---NPKPMPKPRES------------------------VRYQCKLCQKHYASKYALGWHI----- 509
               :|..:|.|.|:                        |..||..|.|.:.::::|..|.     
 Worm   287 PSEDPNYIPLPGENNGGLVPRFDYYGRIKQLKRPYKKKVSPQCPFCDKRFRNEFSLKKHFAKKHE 351

  Fly   510 ----------------------------------------------------KSHTDANA-YKCQ 521
                                                                |.|..||: ::|.
 Worm   352 EMVEFQQCLKCFKCVENDAEMANHDCELTYVCFECTPIRNLCTDNRLLNHRKKFHRGANSGFRCS 416

  Fly   522 RCSKSYSDPNKLKRH-EMTHE-KRPLQCDVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRY 584
            .|:..:..|.||::| :|:|. .:..||..|.:.|.....:..||.:|||...:.|:||:.....
 Worm   417 FCNMKFLTPRKLRKHKKMSHVFTKTFQCHFCEEIFISEVAVMTHERMHTGIIKFECKVCDFRANR 481

  Fly   585 KYNMKSH 591
            ...|:.|
 Worm   482 YTAMEEH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871
zf-C2H2 385..407 CDD:278523 3/21 (14%)
C2H2 Zn finger 387..407 CDD:275368 3/19 (16%)
zf-H2C2_2 399..422 CDD:290200 6/22 (27%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 1/15 (7%)
C2H2 Zn finger 492..512 CDD:275368 6/76 (8%)
C2H2 Zn finger 520..540 CDD:275368 7/20 (35%)
C2H2 Zn finger 547..567 CDD:275368 5/19 (26%)
zf-met 574..597 CDD:289631 5/18 (28%)
C2H2 Zn finger 575..591 CDD:275368 4/15 (27%)
tra-4NP_001370327.1 COG5236 <329..>519 CDD:227561 31/160 (19%)
C2H2 Zn finger 415..436 CDD:275368 7/20 (35%)
C2H2 Zn finger 444..464 CDD:275368 5/19 (26%)
C2H2 Zn finger 472..490 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.