DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and zfp-2

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_496055.1 Gene:zfp-2 / 174505 WormBaseID:WBGene00009448 Length:422 Species:Caenorhabditis elegans


Alignment Length:458 Identity:112/458 - (24%)
Similarity:174/458 - (37%) Gaps:95/458 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DPANSVLLFHIEVISGVWISHKPDEPRLMCPACKSALDQAIDFREMCISTELKLSQAKPSTDEVQ 249
            || ::::::..||.:.         |.|.|    |.:.|.....|..|..||..::...:.:.||
 Worm     8 DP-SAMVIYEEEVTTA---------PNLPC----SLIQQRSWDEEKPIGYELTNTKCYKTPNGVQ 58

  Fly   250 IEAENENPISSDHDLISDTENTNVEEIEDAGGD--------HVEDEATSDDQTSQEAVDEVAE-S 305
            ..|      :...:.:|.:::...::|.:..|:        |.....:|..|.|..:.....| .
 Worm    59 KTA------TIQREQLSTSKDFGEQQIVEMDGEFSIEGTDMHAIPCTSSSMQPSTSSNPSSGEHQ 117

  Fly   306 PAAQDPLSVALGAKI--FKELLDQYTGKEKARLRKGAPIAS--------KPKAKEKA-AGEQKPK 359
            |.....:::.:|.::  ||.:        .|.....||:.:        ||....|| ||..   
 Worm   118 PVPLRRMAIKIGQRVLRFKVI--------SAEEAPEAPLDTQDSWINDPKPVTTPKALAGLY--- 171

  Fly   360 RSANPKT----KE--ERNLIRRAQLRAKPPNFVCDQCGQAF----RMSHNLRIHMLRHTRTKNYQ 414
            |..|.||    ||  :|: |:.....|:|  |.|..||..|    .|:|:|:.|.|....   :.
 Worm   172 RCTNCKTYFGNKEVYQRH-IQEVHGDARP--FRCFNCGMRFANKTSMTHHLKDHSLLKPM---FS 230

  Fly   415 CTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVKRINPK 479
            |..||:.|.....:..|.::.....|   |..|...|....|.:.|:|..|.|.       .:..
 Worm   231 CDYCPRIFSKLESKTRHHKMHFTRST---CQTCMRFFTTEDALRHHQSTAHPAT-------FDSG 285

  Fly   480 PMPK---PR-ESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMTH 540
            |.|:   |. :|.||.|..|...:..|..:..|.:.||....|.|..|.||::....|..|..||
 Worm   286 PPPEDLLPNGKSARYSCSYCNLRFHFKKDMLVHERIHTGEKPYSCGYCMKSFAQSQALTAHIRTH 350

  Fly   541 EKR-PLQCDVCLKGFYQRTRLREHEL-IHTGE---RPYWCEVCNVNFRYKYNMKSHANSKMHQDN 600
            .|. |..|..|.|.|...:.||:||| .||.|   ||         ....|:.:.....:..::|
 Worm   351 TKELPYGCGKCDKRFRDNSCLRKHELAAHTDEPIVRP---------ISVAYSNQVQKQMQRQREN 406

  Fly   601 ARK 603
            .||
 Worm   407 RRK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 13/54 (24%)
zf-C2H2 385..407 CDD:278523 10/25 (40%)
C2H2 Zn finger 387..407 CDD:275368 9/23 (39%)
zf-H2C2_2 399..422 CDD:290200 6/22 (27%)
C2H2 Zn finger 415..436 CDD:275368 5/20 (25%)
C2H2 Zn finger 444..460 CDD:275368 4/15 (27%)
C2H2 Zn finger 492..512 CDD:275368 4/19 (21%)
C2H2 Zn finger 520..540 CDD:275368 6/19 (32%)
C2H2 Zn finger 547..567 CDD:275368 9/20 (45%)
zf-met 574..597 CDD:289631 1/22 (5%)
C2H2 Zn finger 575..591 CDD:275368 1/15 (7%)
zfp-2NP_496055.1 C2H2 Zn finger 173..194 CDD:275368 7/21 (33%)
C2H2 Zn finger 202..222 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
COG5048 <251..>358 CDD:227381 32/116 (28%)
C2H2 Zn finger 257..278 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..322 CDD:275368 4/19 (21%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
C2H2 Zn finger 358..374 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.