DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6689 and ZNF384

DIOPT Version :9

Sequence 1:NP_650051.1 Gene:CG6689 / 41345 FlyBaseID:FBgn0037877 Length:613 Species:Drosophila melanogaster
Sequence 2:NP_001372672.1 Gene:ZNF384 / 171017 HGNCID:11955 Length:608 Species:Homo sapiens


Alignment Length:448 Identity:100/448 - (22%)
Similarity:161/448 - (35%) Gaps:99/448 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 PDEPRLMCPACKSALDQAIDFREMCISTELKLSQAKPSTDEVQIEAENENPISSDHDLISDTENT 271
            |..|.|:......:|...|.     :.||.|..|..|                  |...|.|:|.
Human    47 PHYPTLLTVPASVSLPSGIS-----MDTESKSDQLTP------------------HSQASVTQNI 88

  Fly   272 NVEEIEDAG-----------------------------GDHVEDEATSDDQTSQEAVDEVAESPA 307
            .|..:...|                             ...:...|:|.......|...|:..|.
Human    89 TVVPVPSTGLMTAGVSCSQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTFPISAPMIVSALPP 153

  Fly   308 AQDPLSVA--LGAKIFKELLDQYTG----------------KEKARLRKGAPIASKP--KAKEKA 352
            ....|.|.  |..|:...|.::..|                |:|..|..|.|..:.|  .:.|..
Human   154 GSQALQVVPDLSKKVASTLTEEGGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDPYVLSPEDD 218

  Fly   353 AGEQKP----KRSANPKTKEERNLIRRAQLRAKPPNFVCD----QCGQAFRMSHNLRIHMLRHTR 409
            ...||.    :...|..|...::|.....:.....|.:||    .|...|.....::||...||.
Human   219 DDHQKDGKTYRSEGNCGTGNGQSLGLMDSVPGSTTNLLCDPGCRMCSLTFYSKSEMQIHSKSHTE 283

  Fly   410 TKNYQCTECPKTFYDAYMRNMHIRIRHRGETPFACGFCSETFAYPGARQKHESEVHNAAPRLIVK 474
            ||.::|..|.|||.::.....|||| |.|..|::|.||.::|......|:| :.:|:   ::..:
Human   284 TKPHKCPHCSKTFANSSYLAQHIRI-HSGAKPYSCNFCEKSFRQLSHLQQH-TRIHS---KMHTE 343

  Fly   475 RINPKPMPKPRESVRYQCKLCQKHYASKYALGWHIKSHTDANAYKCQRCSKSYSDPNKLKRHEMT 539
            .|.|           ::|..|.|.:|:...|..|::.|:.|..|.|..|.|::...:.|::|...
Human   344 TIKP-----------HKCPHCSKTFANTSYLAQHLRIHSGAKPYNCSYCQKAFRQLSHLQQHTRI 397

  Fly   540 HE-KRPLQC--DVCLKGFYQRTRLREHELIHTGERPYWCEVCNVNFRYKYNMKSHANS 594
            |. .||.:|  ..|.|.|.|.:.|:.|...|..::|:.|..|:..:....:::.|.::
Human   398 HTGDRPYKCAHPGCEKAFTQLSNLQSHRRQHNKDKPFKCHNCHRAYTDAASLEVHLST 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6689NP_650051.1 THAP 2..96 CDD:283206
zf-AD 167..240 CDD:214871 8/32 (25%)
zf-C2H2 385..407 CDD:278523 6/25 (24%)
C2H2 Zn finger 387..407 CDD:275368 6/23 (26%)
zf-H2C2_2 399..422 CDD:290200 9/22 (41%)
C2H2 Zn finger 415..436 CDD:275368 9/20 (45%)
C2H2 Zn finger 444..460 CDD:275368 5/15 (33%)
C2H2 Zn finger 492..512 CDD:275368 6/19 (32%)
C2H2 Zn finger 520..540 CDD:275368 5/19 (26%)
C2H2 Zn finger 547..567 CDD:275368 7/21 (33%)
zf-met 574..597 CDD:289631 3/21 (14%)
C2H2 Zn finger 575..591 CDD:275368 2/15 (13%)
ZNF384NP_001372672.1 C2H2 Zn finger 261..281 CDD:275368 4/19 (21%)
COG5048 <284..486 CDD:227381 52/188 (28%)
C2H2 Zn finger 289..309 CDD:275368 9/20 (45%)
C2H2 Zn finger 317..337 CDD:275368 6/20 (30%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
C2H2 Zn finger 406..428 CDD:275368 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 3/20 (15%)
C2H2 Zn finger 466..486 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.