DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and WIP3

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:96 Identity:28/96 - (29%)
Similarity:39/96 - (40%) Gaps:13/96 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PCIC--EHC--------GRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQLKHTEG 275
            ||.|  |.|        .:..||...|..|..|..|:|||.|.:|.:........|.|: |:...
plant   226 PCYCCAEGCKNNINHPRSKPLKDFRTLQTHYKRKHGSKPFSCGKCGKALAVKGDWRTHE-KNCGK 289

  Fly   276 PYACTFCGLEYSTNSSRVRHEREACKKGRAP 306
            .:.|| ||.::....|...|.| :...|.:|
plant   290 LWYCT-CGSDFKHKRSLKDHIR-SFGSGHSP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 7/29 (24%)
C2H2 Zn finger 252..272 CDD:275368 4/19 (21%)
C2H2 Zn finger 279..297 CDD:275368 6/17 (35%)
C2H2 Zn finger 322..339 CDD:275368
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.