DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and CG18764

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:407 Identity:123/407 - (30%)
Similarity:177/407 - (43%) Gaps:83/407 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGKTVVADECLQIFTPAGRKLLQCVRSITNCWLQNVQDLPNHICTDCQVLLSQVQKFRRRCA 69
            |||||..:.......:|.....|:||.:..:|...|.|..:||:.||..|.:.|:|...||.||.
  Fly     5 CRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAILFRERCI 69

  Fly    70 KIEKYFARRRRRMNLGEAPAAMEQLR-VQQAAAP-----DPLG-IDELMSAS------------- 114
            ..:|....|||      :|.|.|... |::.|:|     ||.| :||.:..|             
  Fly    70 LTQKQLVHRRR------SPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEVLDHDSDAHH 128

  Fly   115 ----DIKIEPIQ----LQ-----MEEDPQ-----APYPENQLEQALSYGNAPGEDILPLPEDYGE 161
                |..|:.::    ||     .|||.|     ....:.:||...:      :|......||.|
  Fly   129 DLDEDNYIDSVEDVDALQDMAEVAEEDSQDVESLISSVQKELESICN------DDSNSDNNDYME 187

  Fly   162 AQT-----------EVATTTNEPAQRRSKNTAKIKSKKHTMRVGRKLIHV--KVIDDKQPKRIVD 213
            .|.           ||::..|.|.. .||:.|...:|..|.:..||..:|  |.:.::|   |::
  Fly   188 PQNGSYFNETINEYEVSSNPNTPLP-ESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQ---IIE 248

  Fly   214 RNGPSAK-PCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRRHQ--LKHTEG 275
            |.....| .|:||.|||||.|.||..:|:|||||.|.|.|.||.::.||.||:..||  :...|.
  Fly   249 RKRLQRKRECVCEQCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEK 313

  Fly   276 PYACTFCGLEYSTNSSRVRHER-------------EACKKGRAPQSKWEIIKKGERTFHCEVCDL 327
            ||.|.||...:..:::|:.|||             :.|.|..:.:.:.|:|..|.|.|.|.:|..
  Fly   314 PYDCRFCTKSFHNSNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQ 378

  Fly   328 WFLRAGNFTQHINSSSH 344
            .|.|..:...|:.|..|
  Fly   379 SFQRNTHLKAHLRSKFH 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 24/69 (35%)
C2H2 Zn finger 224..244 CDD:275368 12/19 (63%)
C2H2 Zn finger 252..272 CDD:275368 9/21 (43%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368 4/16 (25%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 24/69 (35%)
C2H2 Zn finger 260..280 CDD:275368 12/19 (63%)
zf-H2C2_2 272..297 CDD:290200 12/24 (50%)
C2H2 Zn finger 288..309 CDD:275368 9/20 (45%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
C2H2 Zn finger 345..365 CDD:275368 3/19 (16%)
C2H2 Zn finger 373..391 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.