DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4820 and CG1792

DIOPT Version :9

Sequence 1:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster


Alignment Length:387 Identity:110/387 - (28%)
Similarity:158/387 - (40%) Gaps:72/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRTCGKTVVADECLQIFTPAGRKLLQCVRSITNCWLQN--VQDLPNHICTDCQVLLSQVQKFRRR 67
            |||||..:.......:|......:|..:..:|..:|..  ..:||..||:.|::.|.....||.|
  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRER 70

  Fly    68 CAKIEKYFARRRRRMNLGEAPAAMEQLRVQQAAAPDPLGID-ELMSASDI-KIEPIQLQMEEDPQ 130
            ..:.:|..   :...|||.| ..:|...|         |:: |:..|.:: :||.|.|..|    
  Fly    71 VIRTQKTL---QESPNLGNA-ELIESFAV---------GVEKEIQYAEEVTEIEVIDLLPE---- 118

  Fly   131 APYPENQLEQALSYGNAPGEDILPLPEDYGEAQTEVATTTNEPAQRRSKNTAKIKSKKHTMRVGR 195
                |:.||:.        |:...:.|...:.|.:|      |||.:       |.::.|.....
  Fly   119 ----EHLLEET--------EEPYEICEQNEQPQVKV------PAQEK-------KLRRSTKTTPT 158

  Fly   196 KLIHVKVIDDKQPKR-----------IVDRNGPSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKP 249
            ....||..|:.|..|           :..:.....:.||||.|||.|...||..:|||||||.|.
  Fly   159 VFTSVKFADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKS 223

  Fly   250 FECDQCHQKCYTLHLLRRHQLKHT-EGPYACTFCGLEYSTNSSRVRHER-----------EACKK 302
            |.||||.|:.||..||||||..|. ...:.|.:|...||..|.|::|||           :.|.|
  Fly   224 FACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNK 288

  Fly   303 GRAPQSKWE---IIKKGERTFHCEVCDLWFLRAGNFTQHINSSSHIENERRKKRKSNPTAIN 361
            ..|...|..   :...|.|.|||:.|.:.|:|..:.|.|..|..|......:....||..::
  Fly   289 SFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071 19/71 (27%)
C2H2 Zn finger 224..244 CDD:275368 11/19 (58%)
C2H2 Zn finger 252..272 CDD:275368 13/19 (68%)
C2H2 Zn finger 279..297 CDD:275368 7/17 (41%)
C2H2 Zn finger 322..339 CDD:275368 5/16 (31%)
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 19/76 (25%)
C2H2 Zn finger 198..218 CDD:275368 11/19 (58%)
C2H2 Zn finger 226..243 CDD:275368 11/16 (69%)
C2H2 Zn finger 254..275 CDD:275368 9/20 (45%)
zf-C2H2 281..303 CDD:278523 4/21 (19%)
C2H2 Zn finger 283..303 CDD:275368 4/19 (21%)
zf-H2C2_2 296..320 CDD:290200 7/23 (30%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I19525
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.